(data stored in ACNUC7421 zone)

EMBL: CP001854.PE58

CP001854.PE58        Location/Qualifiers
FT   CDS             54550..55410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0058"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: aeh:Mlg_0892 MCP methyltransferase, CheR-type;
FT                   PFAM: MCP methyltransferase CheR-type; SMART: MCP
FT                   methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48494"
FT                   /db_xref="GOA:D3F411"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3F411"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ADB48494.1"
FT                   /translation="MSATVPGRTSPQGEISRPNPRPQAERFGDDYTAFCEGVRALTSID
FT                   LLQYKRGQMERRIRSFAQRRGAADLPAYLAQLRGDRAELGEFLDRVTINVSQLWRNPEQ
FT                   WRVLETEVLPELLAESSPGRIKAWSAGCSYGAESYTLAALIRQLDPRARAEIVGTDIDR
FT                   RMVERAKLGRFSADDARSAALPLLRRWFTREDDVWQASSELRSLVRFEVGDLLRMPTKR
FT                   AAYDLVLCRNTVIYFTEDVRDALHERLVASLRPGGYLVIGSTERVSHPRELGLVATHPF
FT                   TYRKS"
     MSATVPGRTS PQGEISRPNP RPQAERFGDD YTAFCEGVRA LTSIDLLQYK RGQMERRIRS        60
     FAQRRGAADL PAYLAQLRGD RAELGEFLDR VTINVSQLWR NPEQWRVLET EVLPELLAES       120
     SPGRIKAWSA GCSYGAESYT LAALIRQLDP RARAEIVGTD IDRRMVERAK LGRFSADDAR       180
     SAALPLLRRW FTREDDVWQA SSELRSLVRF EVGDLLRMPT KRAAYDLVLC RNTVIYFTED       240
     VRDALHERLV ASLRPGGYLV IGSTERVSHP RELGLVATHP FTYRKS                      286
//

If you have problems or comments...

PBIL Back to PBIL home page