(data stored in ACNUC7421 zone)

EMBL: CP001854.PE59

CP001854.PE59        Location/Qualifiers
FT   CDS             55421..57448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0059"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; CheW
FT                   domain protein; Hpt domain protein; Signal transducing
FT                   histidine kinase homodimeric; P2 response regulator binding
FT                   domain protein; SMART: Hpt domain protein; ATP-binding
FT                   region ATPase domain protein; CheW domain protein; KEGG:
FT                   geo:Geob_3829 CheA signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48495"
FT                   /db_xref="GOA:D3F412"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="InterPro:IPR037052"
FT                   /db_xref="UniProtKB/TrEMBL:D3F412"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB48495.1"
FT                   /translation="MDTSEYLPMFLAESREHLQELNLAVVRIEETPDDRDTVDEIFRIA
FT                   HSLKGMSATMGFAAIAALTHQMEDVFELLRQRADGLPREAVDVLFKCLDALEAAVEEIA
FT                   TDGAEQLDPAALIEQLKGLIRERTPEQELDKIGGVDLPDLPTVRELADGSRVVHVAADL
FT                   SDEALMPAVRAFMFFQALAELGELVGSIPAQDGVEQFQGTRLEAWLASDREDHVIEAAA
FT                   AGVSDVEHVAVQEAQDDLMPPSIETLSAAHADAEPALVGGPAVDHAAPARRVATNHAAG
FT                   GAHAGATVRVDAERLDQLMHFMGELVIHRTVVETLAGDADVPGLQQAIQDMARSSQALQ
FT                   AMVMQVRMIPVEAVFLRFPRLVRDLSSKLSKEVELQLVGQETELDRTVVDALGDPLVHL
FT                   VRNALDHGLEPPDEREAAGKPRTGVLEISARHAGGNVVISVRDDGRGVDPAKVAQKAFE
FT                   RGLISEEAIPAVDSQRAAELLFTAGFSTAESTSDISGRGVGMDAVQAKIRELGGEVIVD
FT                   SEFGVGMTASIRLPLTLAIMSALLVEAEGMPFAVPLDRVERTLRLEDHAVRSVAGQRML
FT                   VLRDGVLPLIDAGEALAGRVVPSGEAHDHAVIVRGRDRRLALAVGTLVGQRELVTRPLP
FT                   PEVSDRAAVSGGAVLSNGEISLIVDCDALTARATEPVPVS"
     MDTSEYLPMF LAESREHLQE LNLAVVRIEE TPDDRDTVDE IFRIAHSLKG MSATMGFAAI        60
     AALTHQMEDV FELLRQRADG LPREAVDVLF KCLDALEAAV EEIATDGAEQ LDPAALIEQL       120
     KGLIRERTPE QELDKIGGVD LPDLPTVREL ADGSRVVHVA ADLSDEALMP AVRAFMFFQA       180
     LAELGELVGS IPAQDGVEQF QGTRLEAWLA SDREDHVIEA AAAGVSDVEH VAVQEAQDDL       240
     MPPSIETLSA AHADAEPALV GGPAVDHAAP ARRVATNHAA GGAHAGATVR VDAERLDQLM       300
     HFMGELVIHR TVVETLAGDA DVPGLQQAIQ DMARSSQALQ AMVMQVRMIP VEAVFLRFPR       360
     LVRDLSSKLS KEVELQLVGQ ETELDRTVVD ALGDPLVHLV RNALDHGLEP PDEREAAGKP       420
     RTGVLEISAR HAGGNVVISV RDDGRGVDPA KVAQKAFERG LISEEAIPAV DSQRAAELLF       480
     TAGFSTAEST SDISGRGVGM DAVQAKIREL GGEVIVDSEF GVGMTASIRL PLTLAIMSAL       540
     LVEAEGMPFA VPLDRVERTL RLEDHAVRSV AGQRMLVLRD GVLPLIDAGE ALAGRVVPSG       600
     EAHDHAVIVR GRDRRLALAV GTLVGQRELV TRPLPPEVSD RAAVSGGAVL SNGEISLIVD       660
     CDALTARATE PVPVS                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page