(data stored in ACNUC7421 zone)

EMBL: CP001854.PE6

CP001854.PE6         Location/Qualifiers
FT   CDS             6720..9371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: azo:azo1066 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48442"
FT                   /db_xref="GOA:D3EYQ9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ9"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADB48442.1"
FT                   /translation="MSATDQLSGGNIEPRALEEEMRSAYLDYAMSVIVGRALPDVRDGL
FT                   KPVHRRVLFAMNEMGVQPNRPRAKSSRIVGEVMGKYHPHGDASIYDTLVRMAQDFSMRH
FT                   LLVDGQGNFGSVDDDPAAAMRYTEARLARIATEMLRDIDADTVDFGPNYDGKNQEPLVL
FT                   PARFPNLLVNGSSGIAVGMATNIPPHNLRETIAATIAYIENPEIDVDGLMQHIRGPDFP
FT                   TGGIILGVGGIRDAYATGRGRVRVQARAHIEPLSQGKEAIVVTELPYQVKKGGDGGLIQ
FT                   KIADLVHEKKIPEITDLRDESDRHGMRFVIELKRDVLPKVVLNKLYKHTPMQTTFGVNM
FT                   VALVDNVPKTLSLREVIGRYVDHQREVIVRRTKYELRRAEDRAHILEGLLIAQANIDEV
FT                   IAIIRRSSDREQARINLVNRFELSERQAEAILQMTLGRLTALEVDKLRQEHADLMERIR
FT                   ELREILGDEDRQMAIIKEELQEISDAYGNERRTAISYAEGEIDIEDLIADQQMVITITK
FT                   TGYIKSLPLATYRQQRRGGVGVTGMDMKDGDYIEHLFVTSTHDFLLFFTNRGKVYRSKV
FT                   YELPEASRTAKGRALVNILPLREGERVQSVLSTRDFSEAPYLLFATRKGTVKKTELQAY
FT                   NTPIKADGIIAIKIRDDDELVAVRRVDEGDEVIIVSRAGLTVRFSEQDARSMGRDTSGV
FT                   RGMDVGDSGEVIAMDIARDDQDLLVITENGFGKRTRIDEYRKTARGAKGVRTIRLTEAR
FT                   GGLAGALVVREHQELVFISQNGMVQRTGVRGINRYGRASQGVKVMNVREDDSVRAIALV
FT                   VESDTAEADEALELELGADGVEGGGVVAVDADGAGADGGAPASDASDAPQGDDGDEPPA
FT                   DGDSSSEGDAEV"
     MSATDQLSGG NIEPRALEEE MRSAYLDYAM SVIVGRALPD VRDGLKPVHR RVLFAMNEMG        60
     VQPNRPRAKS SRIVGEVMGK YHPHGDASIY DTLVRMAQDF SMRHLLVDGQ GNFGSVDDDP       120
     AAAMRYTEAR LARIATEMLR DIDADTVDFG PNYDGKNQEP LVLPARFPNL LVNGSSGIAV       180
     GMATNIPPHN LRETIAATIA YIENPEIDVD GLMQHIRGPD FPTGGIILGV GGIRDAYATG       240
     RGRVRVQARA HIEPLSQGKE AIVVTELPYQ VKKGGDGGLI QKIADLVHEK KIPEITDLRD       300
     ESDRHGMRFV IELKRDVLPK VVLNKLYKHT PMQTTFGVNM VALVDNVPKT LSLREVIGRY       360
     VDHQREVIVR RTKYELRRAE DRAHILEGLL IAQANIDEVI AIIRRSSDRE QARINLVNRF       420
     ELSERQAEAI LQMTLGRLTA LEVDKLRQEH ADLMERIREL REILGDEDRQ MAIIKEELQE       480
     ISDAYGNERR TAISYAEGEI DIEDLIADQQ MVITITKTGY IKSLPLATYR QQRRGGVGVT       540
     GMDMKDGDYI EHLFVTSTHD FLLFFTNRGK VYRSKVYELP EASRTAKGRA LVNILPLREG       600
     ERVQSVLSTR DFSEAPYLLF ATRKGTVKKT ELQAYNTPIK ADGIIAIKIR DDDELVAVRR       660
     VDEGDEVIIV SRAGLTVRFS EQDARSMGRD TSGVRGMDVG DSGEVIAMDI ARDDQDLLVI       720
     TENGFGKRTR IDEYRKTARG AKGVRTIRLT EARGGLAGAL VVREHQELVF ISQNGMVQRT       780
     GVRGINRYGR ASQGVKVMNV REDDSVRAIA LVVESDTAEA DEALELELGA DGVEGGGVVA       840
     VDADGAGADG GAPASDASDA PQGDDGDEPP ADGDSSSEGD AEV                         883
//

If you have problems or comments...

PBIL Back to PBIL home page