(data stored in ACNUC7421 zone)

EMBL: CP001854.PE60

CP001854.PE60        Location/Qualifiers
FT   CDS             57475..58071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0060"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: CheC domain protein; KEGG: gur:Gura_0720 CheC,
FT                   inhibitor of MCP methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48496"
FT                   /db_xref="GOA:D3F413"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:D3F413"
FT                   /inference="protein motif:PFAM:PF04509"
FT                   /protein_id="ADB48496.1"
FT                   /translation="MSSDFTELQLDAMRELANIGSGNAATALASMLGREVELSVPRALA
FT                   LPLADAVDAVGPAEKTVASVVLPIVGDLEALVLLLFPTQDAAALCGLLGVEPGTEVGDS
FT                   AIGEIGNILGTSYINALASMAGIAIEPRPPHVVTDMLGAIVASLLAGTAGESGVALVLD
FT                   SELDVADAACSLSFLLLPTTGGIDELLTRLGVGGS"
     MSSDFTELQL DAMRELANIG SGNAATALAS MLGREVELSV PRALALPLAD AVDAVGPAEK        60
     TVASVVLPIV GDLEALVLLL FPTQDAAALC GLLGVEPGTE VGDSAIGEIG NILGTSYINA       120
     LASMAGIAIE PRPPHVVTDM LGAIVASLLA GTAGESGVAL VLDSELDVAD AACSLSFLLL       180
     PTTGGIDELL TRLGVGGS                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page