(data stored in ACNUC7421 zone)

EMBL: CP001854.PE61

CP001854.PE61        Location/Qualifiers
FT   CDS             58094..58615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0061"
FT                   /product="CheD, stimulates methylation of MCP protein"
FT                   /note="PFAM: CheD family protein; KEGG: dat:HRM2_34420
FT                   CheD1"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48497"
FT                   /db_xref="GOA:D3F414"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:D3F414"
FT                   /inference="protein motif:PFAM:PF03975"
FT                   /protein_id="ADB48497.1"
FT                   /translation="MRIVRMGELAVSATPGDELTSIGLGSCIGVALVDRARGVAALAHV
FT                   MLPDATADLDAPAGKYADRAIPALVAAAEELGARRVRLEAVLVGGAQMFDVGVGSALDI
FT                   GARNAVAVRAALQSARIPVRAEQVGGRRGRTMRVHVDPLHVTVKEAGGREAELWNGSPT
FT                   ARRSAAEVTH"
     MRIVRMGELA VSATPGDELT SIGLGSCIGV ALVDRARGVA ALAHVMLPDA TADLDAPAGK        60
     YADRAIPALV AAAEELGARR VRLEAVLVGG AQMFDVGVGS ALDIGARNAV AVRAALQSAR       120
     IPVRAEQVGG RRGRTMRVHV DPLHVTVKEA GGREAELWNG SPTARRSAAE VTH              173
//

If you have problems or comments...

PBIL Back to PBIL home page