(data stored in ACNUC7421 zone)

EMBL: CP001854.PE62

CP001854.PE62        Location/Qualifiers
FT   CDS             58616..59584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0062"
FT                   /product="surface presentation of antigens (SPOA) protein"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; KEGG: nam:NAMH_1346 flagellar motor switch protein
FT                   FliM"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48498"
FT                   /db_xref="GOA:D3F415"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:D3F415"
FT                   /inference="protein motif:PFAM:PF01052"
FT                   /protein_id="ADB48498.1"
FT                   /translation="MSEILTNDQIAALVEAAKHGELPDDSAATRRGRRLKTVDFARPTK
FT                   FTSEQERRIVRTLDMFCQTAAARLTAELRVPLELEVINTTQLTWSAAQQQLPPASLGTP
FT                   LEVAPHDTRMLMTAELPFVLMAIEYLLGGAPERPPRQRKLSEIDWVLSKRLFETLTTQL
FT                   SIVWQDLAGQTLAAQEVDSHVEGMQVAAISEPTLTITLESRINRHSSTLALLIPWVSID
FT                   PVADQIAGRDLRTRADDPRAAALVQAALSGAHVTMRAEVGSVEMAIDDVLGLAPGDLVK
FT                   LSSLAADGVVVYAEDVPIHHAQPGRSGARRAVQIVDRREQS"
     MSEILTNDQI AALVEAAKHG ELPDDSAATR RGRRLKTVDF ARPTKFTSEQ ERRIVRTLDM        60
     FCQTAAARLT AELRVPLELE VINTTQLTWS AAQQQLPPAS LGTPLEVAPH DTRMLMTAEL       120
     PFVLMAIEYL LGGAPERPPR QRKLSEIDWV LSKRLFETLT TQLSIVWQDL AGQTLAAQEV       180
     DSHVEGMQVA AISEPTLTIT LESRINRHSS TLALLIPWVS IDPVADQIAG RDLRTRADDP       240
     RAAALVQAAL SGAHVTMRAE VGSVEMAIDD VLGLAPGDLV KLSSLAADGV VVYAEDVPIH       300
     HAQPGRSGAR RAVQIVDRRE QS                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page