(data stored in ACNUC7421 zone)

EMBL: CP001854.PE63

CP001854.PE63        Location/Qualifiers
FT   CDS             59581..60486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0063"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; CheC domain protein; KEGG: tgr:Tgr7_1329 flagellar
FT                   motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48499"
FT                   /db_xref="GOA:D3F416"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:D3F416"
FT                   /inference="protein motif:PFAM:PF01052"
FT                   /protein_id="ADB48499.1"
FT                   /translation="MNTRDALMRLGASTAEAIAKVLDSLCPDQVERGDVAVLNPDTNPF
FT                   ATLEAPAVAVSVAYVDGVTGANVFVMTAKGARRIAASMMGQPPPEDDASELSVLELSAV
FT                   AEAANQMMAAAAAAIGVVLGQDVEIAPPETRLFNSASEAIDAYEMAPHGARATFRVCDE
FT                   PCRLVQLVPNAFVVRMTRALDEMGVEHVSGGASDGGEGDVHEQVALDDALRDIRVRVWA
FT                   ELGRTRVPLGQAPDMPAGSVLELDRKADDPVDLYVNGLRFASGTLVLTDDGEWALRLAE
FT                   VAGRDASDLQRTPDKEGTVS"
     MNTRDALMRL GASTAEAIAK VLDSLCPDQV ERGDVAVLNP DTNPFATLEA PAVAVSVAYV        60
     DGVTGANVFV MTAKGARRIA ASMMGQPPPE DDASELSVLE LSAVAEAANQ MMAAAAAAIG       120
     VVLGQDVEIA PPETRLFNSA SEAIDAYEMA PHGARATFRV CDEPCRLVQL VPNAFVVRMT       180
     RALDEMGVEH VSGGASDGGE GDVHEQVALD DALRDIRVRV WAELGRTRVP LGQAPDMPAG       240
     SVLELDRKAD DPVDLYVNGL RFASGTLVLT DDGEWALRLA EVAGRDASDL QRTPDKEGTV       300
     S                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page