(data stored in ACNUC7421 zone)

EMBL: CP001854.PE64

CP001854.PE64        Location/Qualifiers
FT   CDS             60486..60845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0064"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: mxa:MXAN_6693 fibril biogenesis
FT                   regulator DifD"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48500"
FT                   /db_xref="GOA:D3F417"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3F417"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48500.1"
FT                   /translation="MARVLVVDDAAFMRKMLTDALSNGGHEVVGEAGNGVEAIQRFQEL
FT                   RPELITLDITMPEKDGLEALREIMAIDPSAKVVMCSALGQEAKVLESIKLGAKDFVVKP
FT                   FQADRVLDAVGKALA"
     MARVLVVDDA AFMRKMLTDA LSNGGHEVVG EAGNGVEAIQ RFQELRPELI TLDITMPEKD        60
     GLEALREIMA IDPSAKVVMC SALGQEAKVL ESIKLGAKDF VVKPFQADRV LDAVGKALA        119
//

If you have problems or comments...

PBIL Back to PBIL home page