(data stored in ACNUC7421 zone)

EMBL: CP001854.PE65

CP001854.PE65        Location/Qualifiers
FT   CDS             60951..61520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0065"
FT                   /product="flagellar biosynthesis protein FliO"
FT                   /note="PFAM: flagellar biosynthesis protein FliO; KEGG:
FT                   bvi:Bcep1808_0048 flagellar biosynthesis protein, FliO"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48501"
FT                   /db_xref="GOA:D3F418"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:D3F418"
FT                   /inference="protein motif:PFAM:PF04347"
FT                   /protein_id="ADB48501.1"
FT                   /translation="MIKASLLPRVVALCAALFTVLCTPALAAGGARDAESTPVDLPTTT
FT                   QPSGDVGGGSGSIVRTIVGLAIVIGVIYGIAWVLRQMKQSKAERSIGGLASVASVALGS
FT                   GKALHLVRAGNELVLVGVADHGVTPVRTYTEQEAQDAGLIDEWGELILPDGAAEPRARA
FT                   ADAGRGAKVPVPGALVETMRKWTVRR"
     MIKASLLPRV VALCAALFTV LCTPALAAGG ARDAESTPVD LPTTTQPSGD VGGGSGSIVR        60
     TIVGLAIVIG VIYGIAWVLR QMKQSKAERS IGGLASVASV ALGSGKALHL VRAGNELVLV       120
     GVADHGVTPV RTYTEQEAQD AGLIDEWGEL ILPDGAAEPR ARAADAGRGA KVPVPGALVE       180
     TMRKWTVRR                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page