(data stored in ACNUC7421 zone)

EMBL: CP001854.PE66

CP001854.PE66        Location/Qualifiers
FT   CDS             61517..62158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0066"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein; KEGG:
FT                   bba:Bd3325 flagellar biosynthesis protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48502"
FT                   /db_xref="GOA:D3F419"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:D3F419"
FT                   /inference="protein motif:TFAM:TIGR01103"
FT                   /protein_id="ADB48502.1"
FT                   /translation="MNTVDGDSAIQVLLLIGAFTLIPAGLFCLTGFTRILIVLGFIRTA
FT                   IGTPTAPPNQVLVGIALFLTLFVMAPTFTQIKETAWDPLEAGRINTAQAVRRAEEPLRQ
FT                   FMFEQTRTKDLALFVRLSRTREQPRTRADIPTTVLIPAFIVSELKTAFQIGFMIFLPFL
FT                   VIDLIVASTLMSMGMIMLPPVFISLPFKILLFVLVDGWALITDSLVRSFN"
     MNTVDGDSAI QVLLLIGAFT LIPAGLFCLT GFTRILIVLG FIRTAIGTPT APPNQVLVGI        60
     ALFLTLFVMA PTFTQIKETA WDPLEAGRIN TAQAVRRAEE PLRQFMFEQT RTKDLALFVR       120
     LSRTREQPRT RADIPTTVLI PAFIVSELKT AFQIGFMIFL PFLVIDLIVA STLMSMGMIM       180
     LPPVFISLPF KILLFVLVDG WALITDSLVR SFN                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page