(data stored in ACNUC7421 zone)

EMBL: CP001854.PE67

CP001854.PE67        Location/Qualifiers
FT   CDS             62172..62447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0067"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ family 3; KEGG: ent:Ent638_2540
FT                   flagellar biosynthesis protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48503"
FT                   /db_xref="GOA:D3F420"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:D3F420"
FT                   /inference="protein motif:TFAM:TIGR01402"
FT                   /protein_id="ADB48503.1"
FT                   /translation="MDQDTVMNLSTQALDLAIKIGGPLLLVGLVVGLVVSVFQAITQIQ
FT                   EQSLSFIPKIIATAVVLVVAGPWMLNQLIAYTENLYRSIPTLVGGG"
     MDQDTVMNLS TQALDLAIKI GGPLLLVGLV VGLVVSVFQA ITQIQEQSLS FIPKIIATAV        60
     VLVVAGPWML NQLIAYTENL YRSIPTLVGG G                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page