(data stored in ACNUC7421 zone)

EMBL: CP001854.PE68

CP001854.PE68        Location/Qualifiers
FT   CDS             62444..63244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0068"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein; KEGG:
FT                   dds:Ddes_0193 flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48504"
FT                   /db_xref="GOA:D3F421"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:D3F421"
FT                   /inference="protein motif:TFAM:TIGR01400"
FT                   /protein_id="ADB48504.1"
FT                   /translation="MNATQTTANQLLAALGVRNVVGFFLVLARVSPLFLVAPMFNSRQV
FT                   PARARTIVALAFALGLYPLAVAGQTLPTEAFAIVGLIVKEMLVGLAFALCVSVMFAAVD
FT                   AAGTLLDFMVGFAFGGSLDPITGNQSAVLARVYSLVAVAIFIAINGDAWLIQGMSRTFD
FT                   IVPLSASPDFASISQGVVAVFTTIFASALAVAAPVLIACVLTDVAFGLVSRVVPQMNVF
FT                   AVGFPVKVIVGLVVVAASLPFVGGWISDQLQLSVGEALQTLRMG"
     MNATQTTANQ LLAALGVRNV VGFFLVLARV SPLFLVAPMF NSRQVPARAR TIVALAFALG        60
     LYPLAVAGQT LPTEAFAIVG LIVKEMLVGL AFALCVSVMF AAVDAAGTLL DFMVGFAFGG       120
     SLDPITGNQS AVLARVYSLV AVAIFIAING DAWLIQGMSR TFDIVPLSAS PDFASISQGV       180
     VAVFTTIFAS ALAVAAPVLI ACVLTDVAFG LVSRVVPQMN VFAVGFPVKV IVGLVVVAAS       240
     LPFVGGWISD QLQLSVGEAL QTLRMG                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page