(data stored in ACNUC7421 zone)

EMBL: CP001854.PE69

CP001854.PE69        Location/Qualifiers
FT   CDS             63248..64324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0069"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: dal:Dalk_1004 flagellar
FT                   biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48505"
FT                   /db_xref="GOA:D3F422"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:D3F422"
FT                   /inference="protein motif:TFAM:TIGR00328"
FT                   /protein_id="ADB48505.1"
FT                   /translation="MADDRTERATPRKRDDARRRGQVARSMDVNGAVVLIAGLFALSLL
FT                   GPAVVGAMETSMRDSFERISDPQAALTAGGLEGIAMSTLRTLALAIGPVAAVCAIAGIV
FT                   ANLGQVGLKPSAEALKPQAQRINPLSGARNVFGPRMFFEGAKSIVKVAVIGVIVAMAVA
FT                   PKMTELSATVGASPGQLAAELVSLVLSISQRAAIAYLVIGAIDYAYQKYTHEKQLRMSM
FT                   QDVKDEFRSQQLPAEVKSMQRRRMMQQARARMMSAVPDADVVVTNPTHFAVALKYDGTK
FT                   PAPIVVAKGQDLIALQIRRLAAEHDVPVIENRPLARSLHATVEVGQMIPEDLYQAVAQV
FT                   LAHVYRVAGNARRKVGAR"
     MADDRTERAT PRKRDDARRR GQVARSMDVN GAVVLIAGLF ALSLLGPAVV GAMETSMRDS        60
     FERISDPQAA LTAGGLEGIA MSTLRTLALA IGPVAAVCAI AGIVANLGQV GLKPSAEALK       120
     PQAQRINPLS GARNVFGPRM FFEGAKSIVK VAVIGVIVAM AVAPKMTELS ATVGASPGQL       180
     AAELVSLVLS ISQRAAIAYL VIGAIDYAYQ KYTHEKQLRM SMQDVKDEFR SQQLPAEVKS       240
     MQRRRMMQQA RARMMSAVPD ADVVVTNPTH FAVALKYDGT KPAPIVVAKG QDLIALQIRR       300
     LAAEHDVPVI ENRPLARSLH ATVEVGQMIP EDLYQAVAQV LAHVYRVAGN ARRKVGAR         358
//

If you have problems or comments...

PBIL Back to PBIL home page