(data stored in ACNUC7421 zone)

EMBL: CP001854.PE7

CP001854.PE7         Location/Qualifiers
FT   CDS             complement(9739..10227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0007"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48443"
FT                   /db_xref="GOA:D3EYR0"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYR0"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADB48443.1"
FT                   /translation="MLVLNATFEPINVCSVRRAVVLLLKAKAEMLEHGEYHLHSGSSTV
FT                   PRPMVIRLVSYVRVPRDTHRRKITRRAVFARDDWTCQYCGSRGNLTVDHVIPRSKGGGS
FT                   TWDNIVASCAPCNRRKGDSLPNQAGMVPKSTPRTPGPNVFIQVASPTIPRAWQQYLAF"
     MLVLNATFEP INVCSVRRAV VLLLKAKAEM LEHGEYHLHS GSSTVPRPMV IRLVSYVRVP        60
     RDTHRRKITR RAVFARDDWT CQYCGSRGNL TVDHVIPRSK GGGSTWDNIV ASCAPCNRRK       120
     GDSLPNQAGM VPKSTPRTPG PNVFIQVASP TIPRAWQQYL AF                          162
//

If you have problems or comments...

PBIL Back to PBIL home page