(data stored in ACNUC7421 zone)

EMBL: CP001854.PE70

CP001854.PE70        Location/Qualifiers
FT   CDS             64321..66399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0070"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: dal:Dalk_1003
FT                   flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48506"
FT                   /db_xref="GOA:D3F423"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:D3F423"
FT                   /inference="protein motif:TFAM:TIGR01398"
FT                   /protein_id="ADB48506.1"
FT                   /translation="MNSPLLRKALGQTDLLAALGVVLIVVMLVIPLPPMLLDFFITLNI
FT                   SAAIAIVVATLYLNRALDFSAFPSLLLLTTMFRLAINVSVTRLILTTGDAGHVIRAFGE
FT                   FVVGGNVIVGLVIFFILVVIQFVVVTNGASRVAEVGARFTLDAMPGKQMAIDADLNAGL
FT                   ITDDEARRRRAEISQEADFYGSMDGASKFVRGDAIAAIVIVLINLLGGLAVGIMQMDMP
FT                   FGEAIQHFSLLTIGDGLAAQIPALLISVATGILVTRAASDRDLGADISDQILKQRKAPL
FT                   VAGGAILAFALVPGLPKIPFIVIGGIFLAVGLALRRADADQAEEDAETARIDAEGTAAA
FT                   QPRDAALEALPIDPLELAIGFGLVRLVDQQNGGTLLSRVSVIRRQIATELGMVIPPVRI
FT                   HDELGLDSHEYVLKVRGTEVARGRIMAGHQLAMDPGDAVGQLQGVPTTEPAFGLPATWV
FT                   TDDQRAEAEALGFTVVDGESVIVTHLTETIRAHASELLTRQDVRALLDQLKESNQAVVD
FT                   EVVPDMLTLGEIQRVLQGLLSEGVSIRDLGTIVEAIGDKARLTRDPALLAEYARQALGR
FT                   TITAPYLDGEQRLRALALDPAIEQEVAASITQTSDGEYLAMDPVRAQALIGALRTQVEH
FT                   ATARGSRPVLLCSARVRRHIRRLVEQALPHLAVCSYNEIAPGITVETIGVIEHELAS"
     MNSPLLRKAL GQTDLLAALG VVLIVVMLVI PLPPMLLDFF ITLNISAAIA IVVATLYLNR        60
     ALDFSAFPSL LLLTTMFRLA INVSVTRLIL TTGDAGHVIR AFGEFVVGGN VIVGLVIFFI       120
     LVVIQFVVVT NGASRVAEVG ARFTLDAMPG KQMAIDADLN AGLITDDEAR RRRAEISQEA       180
     DFYGSMDGAS KFVRGDAIAA IVIVLINLLG GLAVGIMQMD MPFGEAIQHF SLLTIGDGLA       240
     AQIPALLISV ATGILVTRAA SDRDLGADIS DQILKQRKAP LVAGGAILAF ALVPGLPKIP       300
     FIVIGGIFLA VGLALRRADA DQAEEDAETA RIDAEGTAAA QPRDAALEAL PIDPLELAIG       360
     FGLVRLVDQQ NGGTLLSRVS VIRRQIATEL GMVIPPVRIH DELGLDSHEY VLKVRGTEVA       420
     RGRIMAGHQL AMDPGDAVGQ LQGVPTTEPA FGLPATWVTD DQRAEAEALG FTVVDGESVI       480
     VTHLTETIRA HASELLTRQD VRALLDQLKE SNQAVVDEVV PDMLTLGEIQ RVLQGLLSEG       540
     VSIRDLGTIV EAIGDKARLT RDPALLAEYA RQALGRTITA PYLDGEQRLR ALALDPAIEQ       600
     EVAASITQTS DGEYLAMDPV RAQALIGALR TQVEHATARG SRPVLLCSAR VRRHIRRLVE       660
     QALPHLAVCS YNEIAPGITV ETIGVIEHEL AS                                     692
//

If you have problems or comments...

PBIL Back to PBIL home page