(data stored in ACNUC7421 zone)

EMBL: CP001854.PE71

CP001854.PE71        Location/Qualifiers
FT   CDS             66383..68515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0071"
FT                   /product="GTP-binding signal recognition particle SRP54
FT                   G-domain protein"
FT                   /note="PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48507"
FT                   /db_xref="GOA:D3F424"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F424"
FT                   /inference="protein motif:PFAM:PF00448"
FT                   /protein_id="ADB48507.1"
FT                   /translation="MSSQVDDRPKTNGHVPADPSLRTYRGRSLEEILPQIRAELGPDAV
FT                   VVRQRDGLMGGIGGFFQQQFVEVQARAGGGKMRLDVYDDEPALPEPLQQAAAEEPAPPS
FT                   SPAAFEAPRPVGPPASSGPESLAPAPRAGPTAAELLAQATGSAAGDPRTPAEILRAHSG
FT                   TFAKQLADAEERAEPTVRASGAASAAADEPTGRYAPPVPADAAETEPIPLPPRPAPAPV
FT                   PAPEPELPPAARAAPVAPAAPARPARATARRAAAKKRRGAAKGRARAAPAARAPAPRAE
FT                   PAARVPAASAEPATATAAPAARAAPVARTEPVARVPTPEAAPAPRAAPSVRAEPAPRAA
FT                   TSKPRAKPAKPAAAAKPESPASGVGPRTTQALELAAAIAAANLAARAAASALPAPARPP
FT                   VEAAEPAPAQPGTAGPGTELVLATAPSPAPPAASPRVTAPRRSLFGRRSGATTPRRLVD
FT                   APAAAEVTGSLAAHGLAPAAAEELLVDATAHVLPFTPGADVRTAVRSALARRIPLPAPP
FT                   RLGGRVVAFVGAGGGGKTRCTAGLAAAYAQGSSVPVACLTFAPADGGAELTALLKPHGV
FT                   KVEAVATAEAAAKRLAALRAEALVVLDTPAVSPGDPDAVARMAAELAPLQLDEIQLVVP
FT                   ATLSATVAEELVERLAPLQPTGIAMTHADATDHIGAVVDLACATRLPLAYVNSGLELPG
FT                   ALAPADPAQLAERLLS"
     MSSQVDDRPK TNGHVPADPS LRTYRGRSLE EILPQIRAEL GPDAVVVRQR DGLMGGIGGF        60
     FQQQFVEVQA RAGGGKMRLD VYDDEPALPE PLQQAAAEEP APPSSPAAFE APRPVGPPAS       120
     SGPESLAPAP RAGPTAAELL AQATGSAAGD PRTPAEILRA HSGTFAKQLA DAEERAEPTV       180
     RASGAASAAA DEPTGRYAPP VPADAAETEP IPLPPRPAPA PVPAPEPELP PAARAAPVAP       240
     AAPARPARAT ARRAAAKKRR GAAKGRARAA PAARAPAPRA EPAARVPAAS AEPATATAAP       300
     AARAAPVART EPVARVPTPE AAPAPRAAPS VRAEPAPRAA TSKPRAKPAK PAAAAKPESP       360
     ASGVGPRTTQ ALELAAAIAA ANLAARAAAS ALPAPARPPV EAAEPAPAQP GTAGPGTELV       420
     LATAPSPAPP AASPRVTAPR RSLFGRRSGA TTPRRLVDAP AAAEVTGSLA AHGLAPAAAE       480
     ELLVDATAHV LPFTPGADVR TAVRSALARR IPLPAPPRLG GRVVAFVGAG GGGKTRCTAG       540
     LAAAYAQGSS VPVACLTFAP ADGGAELTAL LKPHGVKVEA VATAEAAAKR LAALRAEALV       600
     VLDTPAVSPG DPDAVARMAA ELAPLQLDEI QLVVPATLSA TVAEELVERL APLQPTGIAM       660
     THADATDHIG AVVDLACATR LPLAYVNSGL ELPGALAPAD PAQLAERLLS                  710
//

If you have problems or comments...

PBIL Back to PBIL home page