(data stored in ACNUC7421 zone)

EMBL: CP001854.PE72

CP001854.PE72        Location/Qualifiers
FT   CDS             68598..69269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0072"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48508"
FT                   /db_xref="UniProtKB/TrEMBL:D3F425"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ADB48508.1"
FT                   /translation="MSPLRKRPQRRPGSAAPPPLPEVRQEVDLALPGRERFAARVTQVS
FT                   DEAIVLVLMLDARDPLQLGEVAEMALEFAGPRGLVRIEGQGRVTAYDVVHLRLEGAVEV
FT                   VQRRDFVRVRAVRPMALAPIDEEGTIGDWIDTLTVNVSGNGFLAAGPDTLAIGSAVRFR
FT                   VRVVEGEPPIEGLGRVARASDAGHRGIAIEQLVDDGRRRLVAFIFERERIARRVTRDSE
FT                   L"
     MSPLRKRPQR RPGSAAPPPL PEVRQEVDLA LPGRERFAAR VTQVSDEAIV LVLMLDARDP        60
     LQLGEVAEMA LEFAGPRGLV RIEGQGRVTA YDVVHLRLEG AVEVVQRRDF VRVRAVRPMA       120
     LAPIDEEGTI GDWIDTLTVN VSGNGFLAAG PDTLAIGSAV RFRVRVVEGE PPIEGLGRVA       180
     RASDAGHRGI AIEQLVDDGR RRLVAFIFER ERIARRVTRD SEL                         223
//

If you have problems or comments...

PBIL Back to PBIL home page