(data stored in ACNUC7421 zone)

EMBL: CP001854.PE73

CP001854.PE73        Location/Qualifiers
FT   CDS             69287..69694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: DNJ19; DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48509"
FT                   /db_xref="GOA:D3F426"
FT                   /db_xref="UniProtKB/TrEMBL:D3F426"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48509.1"
FT                   /translation="MAPRDTRARGRQRGARGGGAGRGRRRGSGGGGPTLPSVANHPKAG
FT                   EQVKRAKAWAGLVGFGLVAFVSWRGGVPVEDLLLRSLAGGIIAYLVVWACAVAIWRHLV
FT                   VTELEVVRERRAEEAAARKAAAPPMTDGAEA"
     MAPRDTRARG RQRGARGGGA GRGRRRGSGG GGPTLPSVAN HPKAGEQVKR AKAWAGLVGF        60
     GLVAFVSWRG GVPVEDLLLR SLAGGIIAYL VVWACAVAIW RHLVVTELEV VRERRAEEAA       120
     ARKAAAPPMT DGAEA                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page