(data stored in ACNUC7421 zone)

EMBL: CP001854.PE74

CP001854.PE74        Location/Qualifiers
FT   CDS             69708..69950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0074"
FT                   /product="melanoma antigen family E, 1-like protein"
FT                   /note="KEGG: similar to melanoma antigen family E, 1"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48510"
FT                   /db_xref="UniProtKB/TrEMBL:D3F427"
FT                   /inference="similar to AA sequence:KEGG:100021553"
FT                   /protein_id="ADB48510.1"
FT                   /translation="MVDRINPIIPRNPDIFPVPSVGRPRVSEQERDQRRREREDDEREQ
FT                   EQERRRAAAAARRAADAAAADAGEDDERPHVDLIA"
     MVDRINPIIP RNPDIFPVPS VGRPRVSEQE RDQRRRERED DEREQEQERR RAAAAARRAA        60
     DAAAADAGED DERPHVDLIA                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page