(data stored in ACNUC7421 zone)

EMBL: CP001854.PE75

CP001854.PE75        Location/Qualifiers
FT   CDS             70083..70874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0075"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gsu:GSU3038
FT                   flagellin FliC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48511"
FT                   /db_xref="GOA:D3F428"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D3F428"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ADB48511.1"
FT                   /translation="MSLRINTNVEAFNAHRNLESTSGKLAKSMERLSSGFRINRAADDA
FT                   AGLAISEKLRGQIGGLNQARRNVQDGISLVQTAEGSLTEVHSMLQRVRELAVQHATGTL
FT                   ATTDRGAIMSEVAQLAAEIDRIGTTAQFNGIRLLDGSAASITFQVGANDSETISVATVR
FT                   LSDAVRGMRADAALRDIDTAIANVSDARAVFGAVQNRLEHTYNNLSVYQENLTASESRI
FT                   RDVDMAAEMVNFTKNNILQQAGTSMLAQAQQAPQSVLSLLR"
     MSLRINTNVE AFNAHRNLES TSGKLAKSME RLSSGFRINR AADDAAGLAI SEKLRGQIGG        60
     LNQARRNVQD GISLVQTAEG SLTEVHSMLQ RVRELAVQHA TGTLATTDRG AIMSEVAQLA       120
     AEIDRIGTTA QFNGIRLLDG SAASITFQVG ANDSETISVA TVRLSDAVRG MRADAALRDI       180
     DTAIANVSDA RAVFGAVQNR LEHTYNNLSV YQENLTASES RIRDVDMAAE MVNFTKNNIL       240
     QQAGTSMLAQ AQQAPQSVLS LLR                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page