(data stored in ACNUC7421 zone)

EMBL: CP001854.PE76

CP001854.PE76        Location/Qualifiers
FT   CDS             70967..71764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0076"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gsu:GSU3038
FT                   flagellin FliC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48512"
FT                   /db_xref="GOA:D3F429"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D3F429"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ADB48512.1"
FT                   /translation="MSLRINTNVEAFNAHRNLEGTSSKLAKSMERLSSGFRINRAADDA
FT                   AGLAISEKLRGQIGGLNQARRNVQDGISLVQTAEGSLTEVHSMLQRVRELAVQHATGTL
FT                   AGTDRAAIVSEVTQLTDEIRRISNTAQFNKIDLLRADATIDFQVGANDRETISVATIAL
FT                   SRAVPATLDITARTALADIDRAIGAVSDQRAVFGAVQNRLEHTYNNLSVYQENLTASES
FT                   RIRDVDMAAEMVNFTKNNILQQAGTSMLAQAQQAPQSVLSLLR"
     MSLRINTNVE AFNAHRNLEG TSSKLAKSME RLSSGFRINR AADDAAGLAI SEKLRGQIGG        60
     LNQARRNVQD GISLVQTAEG SLTEVHSMLQ RVRELAVQHA TGTLAGTDRA AIVSEVTQLT       120
     DEIRRISNTA QFNKIDLLRA DATIDFQVGA NDRETISVAT IALSRAVPAT LDITARTALA       180
     DIDRAIGAVS DQRAVFGAVQ NRLEHTYNNL SVYQENLTAS ESRIRDVDMA AEMVNFTKNN       240
     ILQQAGTSML AQAQQAPQSV LSLLR                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page