(data stored in ACNUC7421 zone)

EMBL: CP001854.PE77

CP001854.PE77        Location/Qualifiers
FT   CDS             71855..72655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0077"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gsu:GSU3038
FT                   flagellin FliC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48513"
FT                   /db_xref="GOA:D3F430"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D3F430"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ADB48513.1"
FT                   /translation="MSLRINTNVEAFNAHRNLEGTSSKLAKSMERLSSGFRINRAADDA
FT                   AGLAISEKLRGQIGGLNQARRNVQDGISLVQTAEGSLTEVHSMLQRVRELKVQHATGTL
FT                   ATTDRDAIVSEVRQLTAEIDRIGDTAQFNGIRLLDARTTISFQVGANDTEMISVDTFAL
FT                   RTAVDTGRLATLGTATLSEIDRAIGAVSDQRAVFGAVQNRLEHTYNNLSVYQENLTASE
FT                   SRIRDVDMAAEMVNFTKNNILQQAGTSMLAQAQQAPQSVLSLLR"
     MSLRINTNVE AFNAHRNLEG TSSKLAKSME RLSSGFRINR AADDAAGLAI SEKLRGQIGG        60
     LNQARRNVQD GISLVQTAEG SLTEVHSMLQ RVRELKVQHA TGTLATTDRD AIVSEVRQLT       120
     AEIDRIGDTA QFNGIRLLDA RTTISFQVGA NDTEMISVDT FALRTAVDTG RLATLGTATL       180
     SEIDRAIGAV SDQRAVFGAV QNRLEHTYNN LSVYQENLTA SESRIRDVDM AAEMVNFTKN       240
     NILQQAGTSM LAQAQQAPQS VLSLLR                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page