(data stored in ACNUC7421 zone)

EMBL: CP001854.PE78

CP001854.PE78        Location/Qualifiers
FT   CDS             72889..73680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0078"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gsu:GSU3038
FT                   flagellin FliC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48514"
FT                   /db_xref="GOA:D3F431"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:D3F431"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ADB48514.1"
FT                   /translation="MSLRINTNVEAFNAHRNLEGTSSKLAKSMERLSSGFRINRAADDA
FT                   AGLAISEKLRGQIGGLNQARRNVQDGISLVQTAEGSLTEVHSMLQRVRELAVQHATGTL
FT                   AREDRGAIASEIAQLTQEVERIGTTSQFNGITLLDGRNATVAFQVGANDGETISVATVS
FT                   LQARVGRLDQTSTLAQIDTAIANVSDARAVFGAVQNRLEHTYNNLSVYQENLTASESRI
FT                   RDVDMAAEMVNFTKNNILQQAGTSMLAQAQQAPQSVLSLLR"
     MSLRINTNVE AFNAHRNLEG TSSKLAKSME RLSSGFRINR AADDAAGLAI SEKLRGQIGG        60
     LNQARRNVQD GISLVQTAEG SLTEVHSMLQ RVRELAVQHA TGTLAREDRG AIASEIAQLT       120
     QEVERIGTTS QFNGITLLDG RNATVAFQVG ANDGETISVA TVSLQARVGR LDQTSTLAQI       180
     DTAIANVSDA RAVFGAVQNR LEHTYNNLSV YQENLTASES RIRDVDMAAE MVNFTKNNIL       240
     QQAGTSMLAQ AQQAPQSVLS LLR                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page