(data stored in ACNUC7421 zone)

EMBL: CP001854.PE79

CP001854.PE79        Location/Qualifiers
FT   CDS             73760..74446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0079"
FT                   /product="CHAP domain containing protein"
FT                   /note="PFAM: CHAP domain containing protein; KEGG:
FT                   bam:Bamb_5483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48515"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3F432"
FT                   /inference="protein motif:PFAM:PF05257"
FT                   /protein_id="ADB48515.1"
FT                   /translation="MSLAAAIARIDEIQSAFTPRVPPTQSFNGGAAAPSAVTASASSAN
FT                   AFSNVLNGALSNTGVVTPGTAGAPGLYAPGGVLTNGGAGAGAPAMVALAQGEVGQAEFP
FT                   PGSNDSPRIATYRESTAGSGVGPWCAYFTSWLADQAGAPLGDSGQGFGRVDDVYAWAQR
FT                   TGRAVPNGPGAVPQPGDLIVWDEHIGMVEQVLPDGRIQTIEGNSSDQVKRNVHEAGSAL
FT                   GYVRMS"
     MSLAAAIARI DEIQSAFTPR VPPTQSFNGG AAAPSAVTAS ASSANAFSNV LNGALSNTGV        60
     VTPGTAGAPG LYAPGGVLTN GGAGAGAPAM VALAQGEVGQ AEFPPGSNDS PRIATYREST       120
     AGSGVGPWCA YFTSWLADQA GAPLGDSGQG FGRVDDVYAW AQRTGRAVPN GPGAVPQPGD       180
     LIVWDEHIGM VEQVLPDGRI QTIEGNSSDQ VKRNVHEAGS ALGYVRMS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page