(data stored in ACNUC7421 zone)

EMBL: CP001854.PE8

CP001854.PE8         Location/Qualifiers
FT   CDS             complement(10401..11240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0008"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ade:Adeh_1779 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48444"
FT                   /db_xref="GOA:D3EYR1"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYR1"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ADB48444.1"
FT                   /translation="MRVGYLGPEGTNSHEALLAALGGEQHEQVPLPTIYDCVVAVQELE
FT                   VDRAFVPIENAIEGSVNAVLDALAVDAEQVRIVGEAIHPIHTCLIAPAPIELSAIETVL
FT                   SHPQANGQCAHFLRTRLPQARVLAASSTAEAVRAVAEGDAGPNAAALGSRLAAEQYGCE
FT                   ILRAGVDDVAGNETRFVWLAPEGTSAGEHGPWKTAIVFWGVGAEAPGWLVRCLSEFAFR
FT                   GVNLTRIESRPRKQGLGRYMFFLDLEGSEEEGPVAEALTALRGHTEHLRVLGSFPAA"
     MRVGYLGPEG TNSHEALLAA LGGEQHEQVP LPTIYDCVVA VQELEVDRAF VPIENAIEGS        60
     VNAVLDALAV DAEQVRIVGE AIHPIHTCLI APAPIELSAI ETVLSHPQAN GQCAHFLRTR       120
     LPQARVLAAS STAEAVRAVA EGDAGPNAAA LGSRLAAEQY GCEILRAGVD DVAGNETRFV       180
     WLAPEGTSAG EHGPWKTAIV FWGVGAEAPG WLVRCLSEFA FRGVNLTRIE SRPRKQGLGR       240
     YMFFLDLEGS EEEGPVAEAL TALRGHTEHL RVLGSFPAA                              279
//

If you have problems or comments...

PBIL Back to PBIL home page