(data stored in ACNUC7421 zone)

EMBL: CP001854.PE80

CP001854.PE80        Location/Qualifiers
FT   CDS             74518..75249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0080"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: regulatory
FT                   protein LuxR; response regulator receiver; KEGG:
FT                   mfa:Mfla_1714 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48516"
FT                   /db_xref="GOA:D3F433"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3F433"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48516.1"
FT                   /translation="MTLFDEHDRGEAGARSGPDGLGEISVRRGPVTVVVVDPHAPVREG
FT                   LPPLLARDGIDVVATAATGDGAEAVIGHHAPDVALVALDLADVDGIVLLRRLAQRGSRS
FT                   AVVLYTDADDPQQSAVALHAGAAGVIAKRRSIAELSNALRAVAAGRLWFNEPGDLPMPP
FT                   RRLSPLLTDLRERRSSALSSAELRVLALVAEGSSTEEAAELLSLSPHTVRTHLRNVMRK
FT                   LEASSRAHAVAIAIRESAIKL"
     MTLFDEHDRG EAGARSGPDG LGEISVRRGP VTVVVVDPHA PVREGLPPLL ARDGIDVVAT        60
     AATGDGAEAV IGHHAPDVAL VALDLADVDG IVLLRRLAQR GSRSAVVLYT DADDPQQSAV       120
     ALHAGAAGVI AKRRSIAELS NALRAVAAGR LWFNEPGDLP MPPRRLSPLL TDLRERRSSA       180
     LSSAELRVLA LVAEGSSTEE AAELLSLSPH TVRTHLRNVM RKLEASSRAH AVAIAIRESA       240
     IKL                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page