(data stored in ACNUC7421 zone)

EMBL: CP001854.PE81

CP001854.PE81        Location/Qualifiers
FT   CDS             complement(75239..76069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0081"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   gsu:GSU0387 undecaprenol kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48517"
FT                   /db_xref="GOA:D3F434"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D3F434"
FT                   /inference="protein motif:PFAM:PF02673"
FT                   /protein_id="ADB48517.1"
FT                   /translation="MSEQPAALPLRHALALGVLHGPAELLPISSSGHITLVPWLLRWPY
FT                   AELDPELRKAFEVALHAGTAAALLIGLRDEVGEAARGLDRRRIELIVLSFAPAGIAAFA
FT                   FERPIERRLGTPATIAAGLVLGSLAMALADRAPQERPREDAGWRDALALGLAQATALVP
FT                   GVSRNGATLAAARARGFTREDANALSRHVALPIIVAATVLKGTRLLRRGLPPQTRAAFA
FT                   IGTAASFASTLGSTWLIRQVERDRSLAPYAAYRFGLAGVVGWRLRRARAAALRA"
     MSEQPAALPL RHALALGVLH GPAELLPISS SGHITLVPWL LRWPYAELDP ELRKAFEVAL        60
     HAGTAAALLI GLRDEVGEAA RGLDRRRIEL IVLSFAPAGI AAFAFERPIE RRLGTPATIA       120
     AGLVLGSLAM ALADRAPQER PREDAGWRDA LALGLAQATA LVPGVSRNGA TLAAARARGF       180
     TREDANALSR HVALPIIVAA TVLKGTRLLR RGLPPQTRAA FAIGTAASFA STLGSTWLIR       240
     QVERDRSLAP YAAYRFGLAG VVGWRLRRAR AAALRA                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page