(data stored in ACNUC7421 zone)

EMBL: CP001854.PE82

CP001854.PE82        Location/Qualifiers
FT   CDS             complement(76066..76731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0082"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   ank:AnaeK_1303 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48518"
FT                   /db_xref="GOA:D3F435"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D3F435"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADB48518.1"
FT                   /translation="MLVLASITEPLVNMATDVVGSLGLAGVFVLMVLESACIPIPSEAT
FT                   MLFAGFNVAQGEYSLLLVTLVGASANLVGSWIAYGVGYFGRLELLEKHGRKLHVSPRSL
FT                   AQADRWFEKHGSAAVLVTRMLPIVRTFISLPAGVSRMPFIRFSVLTFIGCLPWVFMLAF
FT                   IGREARDNWTAWKDSLHYVDYAVAVAIVAVAVYYGLRWRRNRNAPPVADEQATTDAAL"
     MLVLASITEP LVNMATDVVG SLGLAGVFVL MVLESACIPI PSEATMLFAG FNVAQGEYSL        60
     LLVTLVGASA NLVGSWIAYG VGYFGRLELL EKHGRKLHVS PRSLAQADRW FEKHGSAAVL       120
     VTRMLPIVRT FISLPAGVSR MPFIRFSVLT FIGCLPWVFM LAFIGREARD NWTAWKDSLH       180
     YVDYAVAVAI VAVAVYYGLR WRRNRNAPPV ADEQATTDAA L                           221
//

If you have problems or comments...

PBIL Back to PBIL home page