(data stored in ACNUC7421 zone)

EMBL: CP001854.PE83

CP001854.PE83        Location/Qualifiers
FT   CDS             complement(76796..78388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48519"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D3F436"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48519.1"
FT                   /translation="MRRIILAAFAVLLLHAAPSMAAECRNLALVANGGVASASSEYSGW
FT                   PATALNNGTRETSIDRHWSDGTRFIWPDWAAIEWSSPTRLDQIVVRGLVFTPNKTVAER
FT                   TLDRTRVQYWDDATSTWVDIVGRSGQDNPILAWTGPTHAEDGAEIKQFDFASITTTRIR
FT                   VQIEEGPTVLTGGYSSLDEIEAYDRGGCDPPASQCSNRGLDGIASASSTHSSGLYPVTG
FT                   VNNGQVESGATKGYWNDDTNGVWPDWVQVAWAQPLTINRVVARIPLAQAGFPTGEITLR
FT                   RTRIQYWDATTSTWVDVVGRSGQSNPILDWTGPIGRADGTETRMFHIAPVTTTKIRAVI
FT                   EDGSTDGWSWLDELEAYAADCATPSNENLALGTNAGTAIASSEYSSLASIAKLNDGRRQ
FT                   THLGRTYWMDGTGFSWPDWAGIKWSSPRSLNRIVLRGPALYSSYPTDRRTLGRTRVQYW
FT                   SDDSSTWVDVVGRSGQDNPILNWVMPPDMTDGSEIRQFDFPTVATRRIRALIEEGGTHG
FT                   WSFMEEIEAYWMS"
     MRRIILAAFA VLLLHAAPSM AAECRNLALV ANGGVASASS EYSGWPATAL NNGTRETSID        60
     RHWSDGTRFI WPDWAAIEWS SPTRLDQIVV RGLVFTPNKT VAERTLDRTR VQYWDDATST       120
     WVDIVGRSGQ DNPILAWTGP THAEDGAEIK QFDFASITTT RIRVQIEEGP TVLTGGYSSL       180
     DEIEAYDRGG CDPPASQCSN RGLDGIASAS STHSSGLYPV TGVNNGQVES GATKGYWNDD       240
     TNGVWPDWVQ VAWAQPLTIN RVVARIPLAQ AGFPTGEITL RRTRIQYWDA TTSTWVDVVG       300
     RSGQSNPILD WTGPIGRADG TETRMFHIAP VTTTKIRAVI EDGSTDGWSW LDELEAYAAD       360
     CATPSNENLA LGTNAGTAIA SSEYSSLASI AKLNDGRRQT HLGRTYWMDG TGFSWPDWAG       420
     IKWSSPRSLN RIVLRGPALY SSYPTDRRTL GRTRVQYWSD DSSTWVDVVG RSGQDNPILN       480
     WVMPPDMTDG SEIRQFDFPT VATRRIRALI EEGGTHGWSF MEEIEAYWMS                  530
//

If you have problems or comments...

PBIL Back to PBIL home page