(data stored in ACNUC7421 zone)

EMBL: CP001854.PE84

CP001854.PE84        Location/Qualifiers
FT   CDS             78557..79387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0084"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: oan:Oant_3013
FT                   2,5-didehydrogluconate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48520"
FT                   /db_xref="GOA:D3F437"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3F437"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADB48520.1"
FT                   /translation="MTKIPTLTLNDGTEIPQLGFGVFQVPPQETAQAVAQALEAGYRHI
FT                   DTAAAYRNEEGVGEAVAASGIPREALFVTTKLWNADQGYDEALRAFDASARRLRLDVVD
FT                   LYLIHWPTPARDRYVPSWRAFERLQADGRVRSIGVSNFQPAHLRRLFDEGEVVPAINQV
FT                   ELHPYLQQPELRAFHAEHEIATEAWSPLAQGAVLDDPAIVAIAQAHGKTPAQVVLRWHL
FT                   QLGNVVIPKSVTPARIAENLDVFDFALSDEQLAAIAALDRGERTGPDPDTMEIA"
     MTKIPTLTLN DGTEIPQLGF GVFQVPPQET AQAVAQALEA GYRHIDTAAA YRNEEGVGEA        60
     VAASGIPREA LFVTTKLWNA DQGYDEALRA FDASARRLRL DVVDLYLIHW PTPARDRYVP       120
     SWRAFERLQA DGRVRSIGVS NFQPAHLRRL FDEGEVVPAI NQVELHPYLQ QPELRAFHAE       180
     HEIATEAWSP LAQGAVLDDP AIVAIAQAHG KTPAQVVLRW HLQLGNVVIP KSVTPARIAE       240
     NLDVFDFALS DEQLAAIAAL DRGERTGPDP DTMEIA                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page