(data stored in ACNUC7421 zone)

EMBL: CP001854.PE85

CP001854.PE85        Location/Qualifiers
FT   CDS             79433..80461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0085"
FT                   /product="protein of unknown function DUF354"
FT                   /note="PFAM: protein of unknown function DUF354; KEGG:
FT                   lch:Lcho_1392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48521"
FT                   /db_xref="InterPro:IPR007152"
FT                   /db_xref="UniProtKB/TrEMBL:D3F438"
FT                   /inference="protein motif:PFAM:PF04007"
FT                   /protein_id="ADB48521.1"
FT                   /translation="MRVWIDLTNSPHVVVMRPVIELLRADGHEVHVTARDFAQTLQLCE
FT                   RFGIDHTAIGHHRGGKLSAKGLGLAQRSGALVRWARRRGGRAGFDLALGHGSNDVTVAA
FT                   ALLRIPCSTTFDYEWATVQHNVNCRLAQAVVVPDAIPPERFARYGAVGKLQRYPGLKEE
FT                   YYLADFEPDPAILGELGLDPAEPIVVVRTPPSVSLYHRFEHDTFGAVLERLREQGTQAV
FT                   VLPRTPEQREQLREVGGFILPERAIDAQSLIAFADLMVSAGGTMNREAVALGTPVFTSF
FT                   EGRLGAVDERLIGEGRLRRLTDPDEVVVVKRPGAADGSAPDRIRRDPRDFLRLLAAPVG
FT                   GL"
     MRVWIDLTNS PHVVVMRPVI ELLRADGHEV HVTARDFAQT LQLCERFGID HTAIGHHRGG        60
     KLSAKGLGLA QRSGALVRWA RRRGGRAGFD LALGHGSNDV TVAAALLRIP CSTTFDYEWA       120
     TVQHNVNCRL AQAVVVPDAI PPERFARYGA VGKLQRYPGL KEEYYLADFE PDPAILGELG       180
     LDPAEPIVVV RTPPSVSLYH RFEHDTFGAV LERLREQGTQ AVVLPRTPEQ REQLREVGGF       240
     ILPERAIDAQ SLIAFADLMV SAGGTMNREA VALGTPVFTS FEGRLGAVDE RLIGEGRLRR       300
     LTDPDEVVVV KRPGAADGSA PDRIRRDPRD FLRLLAAPVG GL                          342
//

If you have problems or comments...

PBIL Back to PBIL home page