(data stored in ACNUC7421 zone)

EMBL: CP001854.PE86

CP001854.PE86        Location/Qualifiers
FT   CDS             80544..82481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0086"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: polysaccharide biosynthesis protein CapD; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; NAD-dependent epimerase/dehydratase; KEGG:
FT                   sfu:Sfum_3360 polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48522"
FT                   /db_xref="GOA:D3F439"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F439"
FT                   /inference="protein motif:PFAM:PF02719"
FT                   /protein_id="ADB48522.1"
FT                   /translation="MRRWYRSGAIPVHRHSLIQLVVDGALVALAYVLAFQLRFDSGIPR
FT                   RYELLRDDTIWWIVPVCLVVFVLFGLYQRLWTYVGQRDYEAVVKAVLVSAVLVVGAIAL
FT                   IHPVQVETHNGVSVAVGMPTGVAAMWLLLMGVSMAAVRFVVHLAFEGRKRGLKVVKGAR
FT                   DVLVIGGGDGGRLLVRELVRNPTLRLRPVGFLDDDPRKRGMKDEHGLKVLGTTSDADLA
FT                   RVLDNAEPHEVIIAIPSAPGTLRARVVRACRDRGIPVRTLPTVFELLQSESGGMQVMRQ
FT                   LRELSIEDILGREPVRMELERVGAYLTGQVVLVTGAGGSIGSELCRQIARVNPRRMVLV
FT                   DHAEDNLFEILRELEDERHVRTAIPVLADCKEEERMREVLTEHRPAVVFHAAAYKHVGM
FT                   MEQNPVEAVRNNALATRLVARIAGEAGVRTFVLVSTDKAVKPATVMGASKALAEWAVEA
FT                   AATRHPGTRYATVRFGNVLGSSGSVVPIFRRQIAAGGPVTITDPRMQRWFMTIPEAVQL
FT                   IIRSGSLSDRSGDVFVLEMGEPVKIVDLARDMIRLSGLEPEQDIAIEVIGPRPGEKFHE
FT                   ELFNPYERPQPTPAEKILRAERARLDQAWVEGTFGEINLLVLEGDAAGLAAKVAELAAM
FT                   RTAPGPQVPS"
     MRRWYRSGAI PVHRHSLIQL VVDGALVALA YVLAFQLRFD SGIPRRYELL RDDTIWWIVP        60
     VCLVVFVLFG LYQRLWTYVG QRDYEAVVKA VLVSAVLVVG AIALIHPVQV ETHNGVSVAV       120
     GMPTGVAAMW LLLMGVSMAA VRFVVHLAFE GRKRGLKVVK GARDVLVIGG GDGGRLLVRE       180
     LVRNPTLRLR PVGFLDDDPR KRGMKDEHGL KVLGTTSDAD LARVLDNAEP HEVIIAIPSA       240
     PGTLRARVVR ACRDRGIPVR TLPTVFELLQ SESGGMQVMR QLRELSIEDI LGREPVRMEL       300
     ERVGAYLTGQ VVLVTGAGGS IGSELCRQIA RVNPRRMVLV DHAEDNLFEI LRELEDERHV       360
     RTAIPVLADC KEEERMREVL TEHRPAVVFH AAAYKHVGMM EQNPVEAVRN NALATRLVAR       420
     IAGEAGVRTF VLVSTDKAVK PATVMGASKA LAEWAVEAAA TRHPGTRYAT VRFGNVLGSS       480
     GSVVPIFRRQ IAAGGPVTIT DPRMQRWFMT IPEAVQLIIR SGSLSDRSGD VFVLEMGEPV       540
     KIVDLARDMI RLSGLEPEQD IAIEVIGPRP GEKFHEELFN PYERPQPTPA EKILRAERAR       600
     LDQAWVEGTF GEINLLVLEG DAAGLAAKVA ELAAMRTAPG PQVPS                       645
//

If you have problems or comments...

PBIL Back to PBIL home page