(data stored in ACNUC7421 zone)

EMBL: CP001854.PE87

CP001854.PE87        Location/Qualifiers
FT   CDS             82549..83961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48523"
FT                   /db_xref="GOA:D3F440"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D3F440"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48523.1"
FT                   /translation="MLTYALSVRNFVEDIGAYAGFAAVVALALFALLLFAQARELKRLR
FT                   DWGGQAHDRIGELERSVAAALDLARRAQSQQRSQAQGTVAPAGREAVRGPVARGRAAAG
FT                   AAAAPAAGGPPRQAGAGQRAAVASTSAPVRPQLLPSAPVGVGGPALASATVLIPLPGAP
FT                   GSPGGPPAPVQPQHSGPGGPGPRPVTQPAVAASVAGQRGRAVPAAGAGAPASAGARVRD
FT                   AGAAPPPSGSNGHHDDDISEEYEQLPPRRVPPPPPPRRGAGPSTRPRPGGRPQPAAPLR
FT                   AGAAGGGASRAVPPSDPAPHGRRRLIAMIAGVVALVAVAAVAFVVLTGGDDERRPVRVQ
FT                   APVGNGRAQGRSTRQQTRTTPAPPHDQTTVAVLNGTATGGLASTVMTELTGAGFREGTV
FT                   TNASDPNRSVTVVSFRAGKEREAQEVARTLRLSADAVQEIDAGTEAIACANTTPCTVDV
FT                   VVTVGADRQPTQ"
     MLTYALSVRN FVEDIGAYAG FAAVVALALF ALLLFAQARE LKRLRDWGGQ AHDRIGELER        60
     SVAAALDLAR RAQSQQRSQA QGTVAPAGRE AVRGPVARGR AAAGAAAAPA AGGPPRQAGA       120
     GQRAAVASTS APVRPQLLPS APVGVGGPAL ASATVLIPLP GAPGSPGGPP APVQPQHSGP       180
     GGPGPRPVTQ PAVAASVAGQ RGRAVPAAGA GAPASAGARV RDAGAAPPPS GSNGHHDDDI       240
     SEEYEQLPPR RVPPPPPPRR GAGPSTRPRP GGRPQPAAPL RAGAAGGGAS RAVPPSDPAP       300
     HGRRRLIAMI AGVVALVAVA AVAFVVLTGG DDERRPVRVQ APVGNGRAQG RSTRQQTRTT       360
     PAPPHDQTTV AVLNGTATGG LASTVMTELT GAGFREGTVT NASDPNRSVT VVSFRAGKER       420
     EAQEVARTLR LSADAVQEID AGTEAIACAN TTPCTVDVVV TVGADRQPTQ                  470
//

If you have problems or comments...

PBIL Back to PBIL home page