(data stored in ACNUC7421 zone)

EMBL: CP001854.PE88

CP001854.PE88        Location/Qualifiers
FT   CDS             83987..84781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0088"
FT                   /product="Phosphosulfolactate synthase"
FT                   /EC_number="4.4.1.19"
FT                   /note="PFAM: (2R)-phospho-3-sulfolactate synthase ComA;
FT                   KEGG: phosphosulfolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48524"
FT                   /db_xref="GOA:D3F441"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036112"
FT                   /db_xref="UniProtKB/TrEMBL:D3F441"
FT                   /inference="protein motif:PRIAM:4.4.1.19"
FT                   /protein_id="ADB48524.1"
FT                   /translation="MTPPFLDLPQRGGKPRQRGLTHVIDRGLSLAEVDGMLEVAGDAVD
FT                   IVKLGWGTAVVTQNLGVKLARYREHDIPVVLGGTLTELAISQRRVDELVGWLRELGIGH
FT                   VEISDGTITLPHSEKLALIERLAGEFTVLSEVGSKDDTRIMAPYVWVEQIERELEAGAW
FT                   KVIAEARESGTAGIYRADGEVRMGLIDEIAHAIAPERLLFEAPQKEQQVWFVQRFGLDV
FT                   NLGNIAPQDVLSLETLRLGLRSDTVPPAQPDERPAAPERTQR"
     MTPPFLDLPQ RGGKPRQRGL THVIDRGLSL AEVDGMLEVA GDAVDIVKLG WGTAVVTQNL        60
     GVKLARYREH DIPVVLGGTL TELAISQRRV DELVGWLREL GIGHVEISDG TITLPHSEKL       120
     ALIERLAGEF TVLSEVGSKD DTRIMAPYVW VEQIERELEA GAWKVIAEAR ESGTAGIYRA       180
     DGEVRMGLID EIAHAIAPER LLFEAPQKEQ QVWFVQRFGL DVNLGNIAPQ DVLSLETLRL       240
     GLRSDTVPPA QPDERPAAPE RTQR                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page