(data stored in ACNUC7421 zone)

EMBL: CP001854.PE89

CP001854.PE89        Location/Qualifiers
FT   CDS             84778..86577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esa:ESA_02272 flagellar basal body rod
FT                   modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48525"
FT                   /db_xref="UniProtKB/TrEMBL:D3F442"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48525.1"
FT                   /translation="MTRAARIVFGLLVLATLGAFVVGQKLKSTPPLIVRPLVDVVFSPV
FT                   ANDPGKDRRAKISFWLVRGDDITVSIVNDEGRIVRTLADGVAVPKKVRKTWWWDGRTED
FT                   GGRAPDGYYRVRVALIHQGRTVELPDVEIALDTKPPKPRVVSVEPEGDSGPAFLPQRGV
FT                   DAVTVAIRGTEGRKARLQVWRTDVTPARIVDEVDIPGRQASAEWDGTVDGRPAPAGTYL
FT                   MGLLVADRAGNRGTFPAQVPPRSGDVPGRAGVTVRYLAAAPSFTPVRAGASTTVFVDAR
FT                   RRRYSWALRRWGDPRVLARGRGRDVRLRVRTPRGQAGLHVLSIATADHRTQVPIVVRAR
FT                   VPRRVLVVLPSLTWEGLNAVDDDGDGMPNTLDGAGRDASARLGRPLAKGMPTSIPAQEG
FT                   ALLRFLDDNLLRYDLTTDAALAAGTGPSLGDYAGAVFAGDSRWITPQLRRALRRRVQDG
FT                   GRIWSLGTDALRRSVRLRDGLLTQPSTPAPTDALGARPVVPLVESPAPVTLTTSLNGPI
FT                   FDQTGGSFAGYDSYETLASVIPEAELSAAAGPDADTNVIASWQLGDGTAIHTGLPQLAS
FT                   KAADDELDAAALVRSIWSVVGAP"
     MTRAARIVFG LLVLATLGAF VVGQKLKSTP PLIVRPLVDV VFSPVANDPG KDRRAKISFW        60
     LVRGDDITVS IVNDEGRIVR TLADGVAVPK KVRKTWWWDG RTEDGGRAPD GYYRVRVALI       120
     HQGRTVELPD VEIALDTKPP KPRVVSVEPE GDSGPAFLPQ RGVDAVTVAI RGTEGRKARL       180
     QVWRTDVTPA RIVDEVDIPG RQASAEWDGT VDGRPAPAGT YLMGLLVADR AGNRGTFPAQ       240
     VPPRSGDVPG RAGVTVRYLA AAPSFTPVRA GASTTVFVDA RRRRYSWALR RWGDPRVLAR       300
     GRGRDVRLRV RTPRGQAGLH VLSIATADHR TQVPIVVRAR VPRRVLVVLP SLTWEGLNAV       360
     DDDGDGMPNT LDGAGRDASA RLGRPLAKGM PTSIPAQEGA LLRFLDDNLL RYDLTTDAAL       420
     AAGTGPSLGD YAGAVFAGDS RWITPQLRRA LRRRVQDGGR IWSLGTDALR RSVRLRDGLL       480
     TQPSTPAPTD ALGARPVVPL VESPAPVTLT TSLNGPIFDQ TGGSFAGYDS YETLASVIPE       540
     AELSAAAGPD ADTNVIASWQ LGDGTAIHTG LPQLASKAAD DELDAAALVR SIWSVVGAP        599
//

If you have problems or comments...

PBIL Back to PBIL home page