(data stored in ACNUC7421 zone)

EMBL: CP001854.PE9

CP001854.PE9         Location/Qualifiers
FT   CDS             complement(11243..11779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48445"
FT                   /db_xref="GOA:D3EYR2"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48445.1"
FT                   /translation="MDELTSTTGIVAIAGCAVAVIALGVASSVAVALRRVRRDQRAVLG
FT                   EGMRATDLVSHAAGLEREYRALHAFVEEAAGRLHERMGAAEARLDGAIAYHALVRYDAY
FT                   GEMSGHQSTSIALLDAQRNGVVLSSIMHRDAARLYAKQVHRGRGELELSPEEAEAVRLA
FT                   LEPDDADLDAGPRGR"
     MDELTSTTGI VAIAGCAVAV IALGVASSVA VALRRVRRDQ RAVLGEGMRA TDLVSHAAGL        60
     EREYRALHAF VEEAAGRLHE RMGAAEARLD GAIAYHALVR YDAYGEMSGH QSTSIALLDA       120
     QRNGVVLSSI MHRDAARLYA KQVHRGRGEL ELSPEEAEAV RLALEPDDAD LDAGPRGR         178
//

If you have problems or comments...

PBIL Back to PBIL home page