(data stored in ACNUC7421 zone)

EMBL: CP001854.PE90

CP001854.PE90        Location/Qualifiers
FT   CDS             complement(86584..87132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0090"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   hha:Hhal_0938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48526"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D3F443"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ADB48526.1"
FT                   /translation="MDDSLKGKLLLASPALQDPNFARTVVLIAEHNEDGAMGLVLNRPA
FT                   TTTVAESAPELEELVEAEEPIYIGGPVQPSAVIVLAAFEEPAAAGLLVRDDVGFLSAEA
FT                   DFATSRDATRQLRVFAGHAGWGPGQLDEELEREDWIVEPPLPQELFSEDAEELWGDVLT
FT                   RKGGAFALVARMPLDPSVN"
     MDDSLKGKLL LASPALQDPN FARTVVLIAE HNEDGAMGLV LNRPATTTVA ESAPELEELV        60
     EAEEPIYIGG PVQPSAVIVL AAFEEPAAAG LLVRDDVGFL SAEADFATSR DATRQLRVFA       120
     GHAGWGPGQL DEELEREDWI VEPPLPQELF SEDAEELWGD VLTRKGGAFA LVARMPLDPS       180
     VN                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page