(data stored in ACNUC7421 zone)

EMBL: CP001854.PE91

CP001854.PE91        Location/Qualifiers
FT   CDS             complement(87182..88615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0091"
FT                   /product="Carotenoid oxygenase"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: cbd:CBUD_1036
FT                   lignostilbene-alpha,beta- dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48527"
FT                   /db_xref="GOA:D3F444"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:D3F444"
FT                   /inference="protein motif:PFAM:PF03055"
FT                   /protein_id="ADB48527.1"
FT                   /translation="MATDTTETGYAQGFTTLDREVTLDRLQLDGALPEWLEGSLLRTGP
FT                   AQFEIGGRSLNHWFDGLAMLHRFTFGSGEVAYANRFLQSRARRSAEAEGRQVYGEFATD
FT                   PCRSIFGRVQSLFQPKITDNCNVNVARLGDRFVAMTETPMPVEFDPVTLATLGIAYKPP
FT                   GHVTTAHPHGDAATGEAINYVTRFGPKPTYRVYGLAAVDAPPRTIAEVAAKPVAYMHSF
FT                   GLSERYVALVEFPLVVKPLRLVLGTGPFMESFEWEPQRGTTFTVIDRRDGSLRGRYRAP
FT                   PFFAFHHVNAFDDGEQRLVLDLCAYDDAAIVRSLFLDRLRSGTAGAVPDAYLTRCTVDL
FT                   AGGGVTLERRSETPLELPRIDYGAVNGRPYRWVYGAARRAGAPAHGFIDQLVKIDAGDG
FT                   AATTWSEEGCFPGEPVFVGAPGRSSEDDGVCLSVVLDGAAGTSFLLVLDAATFTERARA
FT                   AVPHHIPFSFHGQFARGVA"
     MATDTTETGY AQGFTTLDRE VTLDRLQLDG ALPEWLEGSL LRTGPAQFEI GGRSLNHWFD        60
     GLAMLHRFTF GSGEVAYANR FLQSRARRSA EAEGRQVYGE FATDPCRSIF GRVQSLFQPK       120
     ITDNCNVNVA RLGDRFVAMT ETPMPVEFDP VTLATLGIAY KPPGHVTTAH PHGDAATGEA       180
     INYVTRFGPK PTYRVYGLAA VDAPPRTIAE VAAKPVAYMH SFGLSERYVA LVEFPLVVKP       240
     LRLVLGTGPF MESFEWEPQR GTTFTVIDRR DGSLRGRYRA PPFFAFHHVN AFDDGEQRLV       300
     LDLCAYDDAA IVRSLFLDRL RSGTAGAVPD AYLTRCTVDL AGGGVTLERR SETPLELPRI       360
     DYGAVNGRPY RWVYGAARRA GAPAHGFIDQ LVKIDAGDGA ATTWSEEGCF PGEPVFVGAP       420
     GRSSEDDGVC LSVVLDGAAG TSFLLVLDAA TFTERARAAV PHHIPFSFHG QFARGVA          477
//

If you have problems or comments...

PBIL Back to PBIL home page