(data stored in ACNUC7421 zone)

EMBL: CP001854.PE92

CP001854.PE92        Location/Qualifiers
FT   CDS             complement(88625..89089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48528"
FT                   /db_xref="UniProtKB/TrEMBL:D3F445"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48528.1"
FT                   /translation="MAAPSDAPLALLLLPVPLERFTHAEHARDLLRAPRVLALEPPPLS
FT                   WSRIGRLPGSLAFGIGVRQAKRVRLPGPVRVVIVYEALQLPLAQGLQLRFEGAQLWRAE
FT                   VVAEATAQASLAFDPDDAAGLGDAAGVDAFDRNAPLWERLELLGVAEFKE"
     MAAPSDAPLA LLLLPVPLER FTHAEHARDL LRAPRVLALE PPPLSWSRIG RLPGSLAFGI        60
     GVRQAKRVRL PGPVRVVIVY EALQLPLAQG LQLRFEGAQL WRAEVVAEAT AQASLAFDPD       120
     DAAGLGDAAG VDAFDRNAPL WERLELLGVA EFKE                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page