(data stored in ACNUC7421 zone)

EMBL: CP001854.PE94

CP001854.PE94        Location/Qualifiers
FT   CDS             complement(90614..91552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0094"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bbt:BBta_1007 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48530"
FT                   /db_xref="GOA:D3F4V2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB48530.1"
FT                   /translation="MSIEVSYCIVNTEQRALLERCLDAIAAEQRMLPFATEVLVLDNAS
FT                   RDGSVGMARAHPVTTELIRREQRRGKAENDSTLMQRARGRYCLLLNEDSELMPGATRAL
FT                   HDALDTTEKAATAGAKLLRPDGSQYPSAWRFPTPATAFWAAVGMHKSMTVQSRGDEVRE
FT                   VDWAQSAALLVRREAAARIGWMDPAFFVYSDEVDFCKRLHDAGWKNLYVPRAEAIHHEQ
FT                   LSTGNVPKRRIVELSRNRERYMRKHHSVVSTLLVRWLTAWTYALRALAAYVLPHHDPAR
FT                   YWQHVRATLHPDRGEGLREAAADYNRGGPRL"
     MSIEVSYCIV NTEQRALLER CLDAIAAEQR MLPFATEVLV LDNASRDGSV GMARAHPVTT        60
     ELIRREQRRG KAENDSTLMQ RARGRYCLLL NEDSELMPGA TRALHDALDT TEKAATAGAK       120
     LLRPDGSQYP SAWRFPTPAT AFWAAVGMHK SMTVQSRGDE VREVDWAQSA ALLVRREAAA       180
     RIGWMDPAFF VYSDEVDFCK RLHDAGWKNL YVPRAEAIHH EQLSTGNVPK RRIVELSRNR       240
     ERYMRKHHSV VSTLLVRWLT AWTYALRALA AYVLPHHDPA RYWQHVRATL HPDRGEGLRE       300
     AAADYNRGGP RL                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page