(data stored in ACNUC7421 zone)

EMBL: CP001854.PE95

CP001854.PE95        Location/Qualifiers
FT   CDS             91576..92712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0095"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mpt:Mpe_A0723 glycosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48531"
FT                   /db_xref="GOA:D3F4V3"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB48531.1"
FT                   /translation="MSSSSLRIALVDPSAFTPPYDHALCAALARAGADVELVTSRFAYG
FT                   AVPRGQGYAVTESFYRIAPGAAGSRLRMAAKLAQHVPDMLRLRRHLRASRADVAHFQWL
FT                   TVQPLDVHLLPRRLPVVLTAHDVLPREPRPGQLDAQRRLYERVDAIVVHSEHGAARLRG
FT                   ELRVDPAKVHVIPHGALDQFVPAGGPSAAPPRPLPPELAAVGREKPVVLCFGLLRPYKG
FT                   VDVLLEAWRGIDDAELWVVGLPKMDVAPLHALAPPNVRFVSRFVADDEIAAFFDRADLV
FT                   VLPYREIDQSGVLFTALAFGKPLLLSSVGGFPEVAATGAAALVPPGDAPALHTALRDLL
FT                   ADPAARTRLGAAARAAADGPYSWDGIAQQTLALYESLQ"
     MSSSSLRIAL VDPSAFTPPY DHALCAALAR AGADVELVTS RFAYGAVPRG QGYAVTESFY        60
     RIAPGAAGSR LRMAAKLAQH VPDMLRLRRH LRASRADVAH FQWLTVQPLD VHLLPRRLPV       120
     VLTAHDVLPR EPRPGQLDAQ RRLYERVDAI VVHSEHGAAR LRGELRVDPA KVHVIPHGAL       180
     DQFVPAGGPS AAPPRPLPPE LAAVGREKPV VLCFGLLRPY KGVDVLLEAW RGIDDAELWV       240
     VGLPKMDVAP LHALAPPNVR FVSRFVADDE IAAFFDRADL VVLPYREIDQ SGVLFTALAF       300
     GKPLLLSSVG GFPEVAATGA AALVPPGDAP ALHTALRDLL ADPAARTRLG AAARAAADGP       360
     YSWDGIAQQT LALYESLQ                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page