(data stored in ACNUC7421 zone)

EMBL: CP001854.PE96

CP001854.PE96        Location/Qualifiers
FT   CDS             92759..93907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0096"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   afw:Anae109_2016 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48532"
FT                   /db_xref="GOA:D3F4V4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB48532.1"
FT                   /translation="MPVVKLLFWVCAALVVYAQAGYGLLLALLARVLPARAARTGAPVD
FT                   GGDEALPAVSVIVAAYQEESVIADKVANLKALDYPADRLQVVVACDGSPDATPQRARDA
FT                   GADLVLELPRGGKIRAQDAGVRAASGRIVAFSDANAFWEPDALRRLVAPFAGAPEVGYV
FT                   CGQVSFVNDGGTNQEGLYWRYEMALRGLESRLASVTGGNGAIYATRRESYIEVDPIMGH
FT                   DLSFPFNMVKRGWRALYAADARATEKMVPSIEGEFARKRRMMTHGWPIVLRGGMLKPDG
FT                   YGPLYGLMVFSHRLLRYATPFLHLAVLSTSLVLARRGRPYAAALALQALILLAAALAKA
FT                   IPARPFLVARYYVLTTGALAAGLYDVLREPTEAGWEPPEGTR"
     MPVVKLLFWV CAALVVYAQA GYGLLLALLA RVLPARAART GAPVDGGDEA LPAVSVIVAA        60
     YQEESVIADK VANLKALDYP ADRLQVVVAC DGSPDATPQR ARDAGADLVL ELPRGGKIRA       120
     QDAGVRAASG RIVAFSDANA FWEPDALRRL VAPFAGAPEV GYVCGQVSFV NDGGTNQEGL       180
     YWRYEMALRG LESRLASVTG GNGAIYATRR ESYIEVDPIM GHDLSFPFNM VKRGWRALYA       240
     ADARATEKMV PSIEGEFARK RRMMTHGWPI VLRGGMLKPD GYGPLYGLMV FSHRLLRYAT       300
     PFLHLAVLST SLVLARRGRP YAAALALQAL ILLAAALAKA IPARPFLVAR YYVLTTGALA       360
     AGLYDVLREP TEAGWEPPEG TR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page