(data stored in ACNUC7421 zone)

EMBL: CP001854.PE97

CP001854.PE97        Location/Qualifiers
FT   CDS             93904..94530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0097"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="PFAM: sugar transferase; KEGG: afw:Anae109_2622
FT                   undecaprenyl-phosphate galactose phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48533"
FT                   /db_xref="GOA:D3F4V5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V5"
FT                   /inference="protein motif:PRIAM:2.7.8.6"
FT                   /protein_id="ADB48533.1"
FT                   /translation="MSGRAATPGAADRAARRALDLLLGGIGTIAGAPLVALAAALIRLE
FT                   SPGHPIYKQRRVGRDGRAFEIYKLRTMVRGAEFTGAGLAIQEGDDRITRMGKLLRRTSL
FT                   DELPNLWNVVRGEMSIVGPRPTVQVQVDQYTERQLGRLQVKPGITGWAQINGRASLPWS
FT                   ERIELDLWYVEHQSLKLDLRILSRTWRLVVKGDGLYKGETGGWRT"
     MSGRAATPGA ADRAARRALD LLLGGIGTIA GAPLVALAAA LIRLESPGHP IYKQRRVGRD        60
     GRAFEIYKLR TMVRGAEFTG AGLAIQEGDD RITRMGKLLR RTSLDELPNL WNVVRGEMSI       120
     VGPRPTVQVQ VDQYTERQLG RLQVKPGITG WAQINGRASL PWSERIELDL WYVEHQSLKL       180
     DLRILSRTWR LVVKGDGLYK GETGGWRT                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page