(data stored in ACNUC7421 zone)

EMBL: CP001854.PE98

CP001854.PE98        Location/Qualifiers
FT   CDS             94518..95522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0098"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   msu:MS1491 carbamoyl phosphate synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48534"
FT                   /db_xref="GOA:D3F4V6"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V6"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ADB48534.1"
FT                   /translation="MADMNGRAVLLTGVGKRYDIVSCFAAHTTVIAADPSPLAPAQYAA
FT                   THRFAPPRIDDSGYVPALAEVCARYDVGAVIPLTDLDIEVLAQARADGILPAFVPDPEI
FT                   ARATYDKYEAHLLLESHGLPSPPTVLPGEQPESYPVMVKPRQGSGARSIHLAHDAEEAA
FT                   FFVRYVKEPTMVQRAMDGPEFSIDLLSDLDGRCLNAIPRTMLESRGGESIKGTVIADRE
FT                   LIDLGVNVVETLGVRGPCTVQAFRDREIGLGITDVNTRFGGAFPGPTYATLAAGRTYPE
FT                   LIARMANGERIAPHVGEFDAGRTFTRYYWQLELDAEMQPTGRELVPGGAPPPR"
     MADMNGRAVL LTGVGKRYDI VSCFAAHTTV IAADPSPLAP AQYAATHRFA PPRIDDSGYV        60
     PALAEVCARY DVGAVIPLTD LDIEVLAQAR ADGILPAFVP DPEIARATYD KYEAHLLLES       120
     HGLPSPPTVL PGEQPESYPV MVKPRQGSGA RSIHLAHDAE EAAFFVRYVK EPTMVQRAMD       180
     GPEFSIDLLS DLDGRCLNAI PRTMLESRGG ESIKGTVIAD RELIDLGVNV VETLGVRGPC       240
     TVQAFRDREI GLGITDVNTR FGGAFPGPTY ATLAAGRTYP ELIARMANGE RIAPHVGEFD       300
     AGRTFTRYYW QLELDAEMQP TGRELVPGGA PPPR                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page