(data stored in ACNUC7421 zone)

EMBL: CP001854.PE99

CP001854.PE99        Location/Qualifiers
FT   CDS             complement(95542..97200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0099"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   SMART: Animal peptidoglycan recognition protein PGRP;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; KEGG: PGRPS3;
FT                   peptidoglycan recognition protein short class
FT                   (AGAP006342-PA); K01446 N-acetylmuramoyl-L- alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48535"
FT                   /db_xref="GOA:D3F4V7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V7"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADB48535.1"
FT                   /translation="MLRSVLLAALFALAASAPAVASVASGGAVDFEQPLPPTAAFAASG
FT                   DGPTATPAIAAPRPFDLLGLRWRGGEAHVEARVQRADGRWSRWQELPHAEDVAAGSRRG
FT                   ETVTGPLWTGRAQRYQLRGAHDTALPAGLRAHFVAVERSGATAPPRPAKASVDAPAIVP
FT                   RSQWDPTGSCAPRTPPRYGRVDFSVVHHTESLTSYSRAQAPEVVLGICRFHRNGNGWLD
FT                   IGYNLLVDRFGTVYEGRVGGVEQPVIGAHAGGWNSLSTGVAVIGSFTGSRPPQAAQDAL
FT                   TQVLAWKLQLAGVPAQGTIGEISPGGAENRWSSGTRVAFQRIAGHRDADHTDCPGGAFY
FT                   ALLPRLRGQTANQHEIAADLLTNSPVGGVLSQGGPAALTGRLALAGGQRPVGAPLTLQQ
FT                   RTGEDWSDLDELRTRVDGVWSASLPVTVNGTYRVVSDARGVASPGVRVEVAAGVTARVS
FT                   PQLLRPGRTVTLRGASTPAKERVTVVVERQTRRGAWRRVRRLSLATDAGSYETTLVLAA
FT                   PGVHRFLVTTAADAANAAGAAPVRTASVRRARRAR"
     MLRSVLLAAL FALAASAPAV ASVASGGAVD FEQPLPPTAA FAASGDGPTA TPAIAAPRPF        60
     DLLGLRWRGG EAHVEARVQR ADGRWSRWQE LPHAEDVAAG SRRGETVTGP LWTGRAQRYQ       120
     LRGAHDTALP AGLRAHFVAV ERSGATAPPR PAKASVDAPA IVPRSQWDPT GSCAPRTPPR       180
     YGRVDFSVVH HTESLTSYSR AQAPEVVLGI CRFHRNGNGW LDIGYNLLVD RFGTVYEGRV       240
     GGVEQPVIGA HAGGWNSLST GVAVIGSFTG SRPPQAAQDA LTQVLAWKLQ LAGVPAQGTI       300
     GEISPGGAEN RWSSGTRVAF QRIAGHRDAD HTDCPGGAFY ALLPRLRGQT ANQHEIAADL       360
     LTNSPVGGVL SQGGPAALTG RLALAGGQRP VGAPLTLQQR TGEDWSDLDE LRTRVDGVWS       420
     ASLPVTVNGT YRVVSDARGV ASPGVRVEVA AGVTARVSPQ LLRPGRTVTL RGASTPAKER       480
     VTVVVERQTR RGAWRRVRRL SLATDAGSYE TTLVLAAPGV HRFLVTTAAD AANAAGAAPV       540
     RTASVRRARR AR                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page