(data stored in SCRATCH zone)

EMBL: CP001875.ATPE

CP001875.ATPE        Location/Qualifiers
FT   CDS             23576..23815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="PANA_0022"
FT                   /product="AtpE"
FT                   /note="ATP synthase C chain; Similar to Erwinia
FT                   tasmaniensis Et1/99, F0F1 ATP synthase subunit C (NCBI:
FT                   YP_001909385.1); COG: Energy production and conversion;
FT                   Subcellular localization as predicted by Psort 2.0: Inner
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75189"
FT                   /db_xref="GOA:D4GFS5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFS5"
FT                   /protein_id="ADD75189.1"
FT                   /translation="MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDL
FT                   IPLLRTQFFVVMGLVDAIPMIAVGLGLYVMFAVA"
     MENLNMDLLY MAAAVMMGLA AIGAAIGIGI LGGKFLEGAA RQPDLIPLLR TQFFVVMGLV        60
     DAIPMIAVGL GLYVMFAVA                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page