(data stored in SCRATCH zone)

EMBL: CP001875.BCSA

CP001875.BCSA        Location/Qualifiers
FT   CDS             140640..142745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsA"
FT                   /locus_tag="PANA_0128"
FT                   /product="BcsA"
FT                   /note="Cellulose synthase catalytic subunit [UDP-forming];
FT                   Similar to Pantoea sp. At-9b, cellulose synthase catalytic
FT                   subunit (UDP-forming) (NCBI: ZP_05732369.1); COG: Cell
FT                   wall/membrane/envelope biogenesis; Subcellular localization
FT                   as predicted by Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75295"
FT                   /db_xref="GOA:D4GGJ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR005150"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGJ4"
FT                   /protein_id="ADD75295.1"
FT                   /translation="MGKIGFYLLLLVLAPVAAVIIITPMDSQKQYIFGLISIGMVFLLG
FT                   VSKSRKITVVMVILSALMSSRYIWWRTTETLYFNSEIEAILGIGLYIAELYVWLILILG
FT                   FLQTTWPLKRTIEPLPEDTHLWPTVDVYIPTYNESLDVVRDTVLAAQCIDYPRDKIKVY
FT                   LLDDGKRREFAVFAADVGVGYITRDDNSHAKAGNLNHAMKITKGELICVFDCDHVATRT
FT                   FLQATVGPFLKDPKLALLQTPHYFYSPDPFERNLSAARSIPNEGSLFYGPVQQGNDNWN
FT                   ATFFCGSCAVIRRSALEEIGGFAVETVTEDAHTALKMQRLGWGSAFLAIPLAAGLATER
FT                   LGLHVIQRTRWARGMTQIFRVDNPLFGRGLKWQQRLCYLNAMLHFQFGLPRVVFLTAPL
FT                   AYLLFNLNIIHSSASLIFAYVLPHLVLSLYVNSRMNGRFRYTFWGEIYETVMCFHLVIP
FT                   TILTLLSPKHGKFNVTDKGGVLDQGFFDFHIVRPHVIVAFLLSIGIVAGIVRATMHDYF
FT                   GVDPYVIALNVGWAVFSLIILMAAIAVARETKQVRKTIRIEVQIPAIIHYASGISSRTM
FT                   TSDLSMGGANLDAPDNRHEHDTIEEIDLILKSGTITIPATKISGDEESIRLSFGAMPLA
FT                   RRRELVRVVLARADAWIQPEYKQDNPLTSLGTIIRTVFELFWLTWRDRREKRKSGPDVA
FT                   AKEDSAV"
     MGKIGFYLLL LVLAPVAAVI IITPMDSQKQ YIFGLISIGM VFLLGVSKSR KITVVMVILS        60
     ALMSSRYIWW RTTETLYFNS EIEAILGIGL YIAELYVWLI LILGFLQTTW PLKRTIEPLP       120
     EDTHLWPTVD VYIPTYNESL DVVRDTVLAA QCIDYPRDKI KVYLLDDGKR REFAVFAADV       180
     GVGYITRDDN SHAKAGNLNH AMKITKGELI CVFDCDHVAT RTFLQATVGP FLKDPKLALL       240
     QTPHYFYSPD PFERNLSAAR SIPNEGSLFY GPVQQGNDNW NATFFCGSCA VIRRSALEEI       300
     GGFAVETVTE DAHTALKMQR LGWGSAFLAI PLAAGLATER LGLHVIQRTR WARGMTQIFR       360
     VDNPLFGRGL KWQQRLCYLN AMLHFQFGLP RVVFLTAPLA YLLFNLNIIH SSASLIFAYV       420
     LPHLVLSLYV NSRMNGRFRY TFWGEIYETV MCFHLVIPTI LTLLSPKHGK FNVTDKGGVL       480
     DQGFFDFHIV RPHVIVAFLL SIGIVAGIVR ATMHDYFGVD PYVIALNVGW AVFSLIILMA       540
     AIAVARETKQ VRKTIRIEVQ IPAIIHYASG ISSRTMTSDL SMGGANLDAP DNRHEHDTIE       600
     EIDLILKSGT ITIPATKISG DEESIRLSFG AMPLARRREL VRVVLARADA WIQPEYKQDN       660
     PLTSLGTIIR TVFELFWLTW RDRREKRKSG PDVAAKEDSA V                           701
//

If you have problems or comments...

PBIL Back to PBIL home page