(data stored in SCRATCH zone)

EMBL: CP001875.BSCS

CP001875.BSCS        Location/Qualifiers
FT   CDS             145561..149367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bscS"
FT                   /locus_tag="PANA_0130"
FT                   /product="BscS"
FT                   /note="Cellulose synthase operon protein C precursor;
FT                   Similar to Pantoea sp. At-9b, cellulose synthase operon C
FT                   domain protein (NCBI: ZP_05732371.1); COG: Carbohydrate
FT                   transport and metabolism; Subcellular localization as
FT                   predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75297"
FT                   /db_xref="GOA:D4GGJ6"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGJ6"
FT                   /protein_id="ADD75297.1"
FT                   /translation="MNKNQISAGICRALLLGGALSLSLPLQAAESSNPALQALFDQAAY
FT                   WHQKAHDDLAKASLQKVLMVEPNNTQALYLLALYSQQSGDNAGAMQYRTRLSQVSPDDP
FT                   HLAELDNARQLQTIPQAQLSLARQQARSGNIAAALQTWRNTFSGNEPPASVAAEYYLTM
FT                   AGDRTLLPQAIEALREFSAQHPQDTGAKLALGKALTYQDSTRREGIDLLSTLASGNQDA
FT                   DRSLRQALLWLGPQASDASLYQTWQQRHPQDNAVMDYYRKNVGGAEKGAGFSALNSGDV
FT                   NTAESNFGKVLQANPQDADALAGMGYVAQREGRYQDAADYLQRAAQLGGDQSADRQKQA
FT                   ADARFYAQLASAQQAFKNGDSAQALALSEPLTHAEGEKGVAAGLFRADILRRSNQPDQA
FT                   EQAYRAILKTDPDNRSAREGLFYVLRQQNRSAEANTLLASLPESVRQSVAPRGSSVDPI
FT                   RQQAKRQVAAGNINAAIATLQQGIQRYPQDGWLRLDLARLYRQQGNTMLAAGVMQPVMR
FT                   SGASTTERYAGAINASESGAWQQASSLLAGIPAREQNRDMRELAQRVNFNLQMATADQY
FT                   LAQGSNAAAANTLKALAVNPPDNPVDAGNLAQKLAKAGDINSAVAVVRGNMQRGVQGNA
FT                   GDYAAQIAVLNQAGLDNEAQRFLSLPELQTRSTPKQLAEIREGYLINDVDRLRQQKQYA
FT                   AAYDKLIGALQRDPQNRDLMFAMARLYQDGKMNKDAGVVYDYLMTQDTPSQDARVGAIN
FT                   VALAQNNVQRANELAKGLTSSQTPQRQLLLAQVAEANGDHMQAMRYLRSARGQIIGLQG
FT                   AQPGATPTIGGLALADNPFINRSTSPVGRTPSSYGTVLPWQVAPVSAAGAQEGTLASAN
FT                   TVSSQQAQTLHDVDAMMERLQEKTGTWAQGTVQVRGRDGESGLSQLTEAKAPLTFSTVP
FT                   FGDARFNFTMTPVSLTAGSGAGDAWRRFGTNALEQGKVVAAGLAKVDDVPTATTDSQSA
FT                   SGVELNLALQGDSYKVDLGSTPLGQDLNTLVGGVQWSPKLTDFLTLILTGERRAITDSL
FT                   LSYVGAEDKSSGKRWGNVTKNGGNALLSYDNGDAGLFVGAGAYSYVGNNVASNNNLQAN
FT                   AGVYVRPFYADDRELKVGMSLSWMNFSKNLSYFSYGQGGYFSPQDYASISFPVDFSRTF
FT                   DDLKVNIGGAVGYQSYSQDKSAYFPGDAGRQAQLEQLAANGNVKSAFYEGNSKNGVGYN
FT                   LHAGADYKIDKDVTIGGQLGYDTFGDYNESTAQLYFRYLFGEK"
     MNKNQISAGI CRALLLGGAL SLSLPLQAAE SSNPALQALF DQAAYWHQKA HDDLAKASLQ        60
     KVLMVEPNNT QALYLLALYS QQSGDNAGAM QYRTRLSQVS PDDPHLAELD NARQLQTIPQ       120
     AQLSLARQQA RSGNIAAALQ TWRNTFSGNE PPASVAAEYY LTMAGDRTLL PQAIEALREF       180
     SAQHPQDTGA KLALGKALTY QDSTRREGID LLSTLASGNQ DADRSLRQAL LWLGPQASDA       240
     SLYQTWQQRH PQDNAVMDYY RKNVGGAEKG AGFSALNSGD VNTAESNFGK VLQANPQDAD       300
     ALAGMGYVAQ REGRYQDAAD YLQRAAQLGG DQSADRQKQA ADARFYAQLA SAQQAFKNGD       360
     SAQALALSEP LTHAEGEKGV AAGLFRADIL RRSNQPDQAE QAYRAILKTD PDNRSAREGL       420
     FYVLRQQNRS AEANTLLASL PESVRQSVAP RGSSVDPIRQ QAKRQVAAGN INAAIATLQQ       480
     GIQRYPQDGW LRLDLARLYR QQGNTMLAAG VMQPVMRSGA STTERYAGAI NASESGAWQQ       540
     ASSLLAGIPA REQNRDMREL AQRVNFNLQM ATADQYLAQG SNAAAANTLK ALAVNPPDNP       600
     VDAGNLAQKL AKAGDINSAV AVVRGNMQRG VQGNAGDYAA QIAVLNQAGL DNEAQRFLSL       660
     PELQTRSTPK QLAEIREGYL INDVDRLRQQ KQYAAAYDKL IGALQRDPQN RDLMFAMARL       720
     YQDGKMNKDA GVVYDYLMTQ DTPSQDARVG AINVALAQNN VQRANELAKG LTSSQTPQRQ       780
     LLLAQVAEAN GDHMQAMRYL RSARGQIIGL QGAQPGATPT IGGLALADNP FINRSTSPVG       840
     RTPSSYGTVL PWQVAPVSAA GAQEGTLASA NTVSSQQAQT LHDVDAMMER LQEKTGTWAQ       900
     GTVQVRGRDG ESGLSQLTEA KAPLTFSTVP FGDARFNFTM TPVSLTAGSG AGDAWRRFGT       960
     NALEQGKVVA AGLAKVDDVP TATTDSQSAS GVELNLALQG DSYKVDLGST PLGQDLNTLV      1020
     GGVQWSPKLT DFLTLILTGE RRAITDSLLS YVGAEDKSSG KRWGNVTKNG GNALLSYDNG      1080
     DAGLFVGAGA YSYVGNNVAS NNNLQANAGV YVRPFYADDR ELKVGMSLSW MNFSKNLSYF      1140
     SYGQGGYFSP QDYASISFPV DFSRTFDDLK VNIGGAVGYQ SYSQDKSAYF PGDAGRQAQL      1200
     EQLAANGNVK SAFYEGNSKN GVGYNLHAGA DYKIDKDVTI GGQLGYDTFG DYNESTAQLY      1260
     FRYLFGEK                                                               1268
//

If you have problems or comments...

PBIL Back to PBIL home page