(data stored in SCRATCH zone)

EMBL: CP001875.DAPF

CP001875.DAPF        Location/Qualifiers
FT   CDS             191404..192252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="PANA_0165"
FT                   /product="DapF"
FT                   /note="Diaminopimelate epimerase; Similar to Pantoea sp.
FT                   At-9b, diaminopimelate epimerase (NCBI: ZP_05730678.1);
FT                   COG: Amino acid transport and metabolism; Subcellular
FT                   localization as predicted by Psort 2.0: Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75332"
FT                   /db_xref="GOA:D4GGN1"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGN1"
FT                   /protein_id="ADD75332.1"
FT                   /translation="MAHPAEQKMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRH
FT                   LGIGFDQLLVVEPPYDPDLDFHYRIFNADGSEVAQCGNGARCFARFVQLKGLTNKSDIR
FT                   VSTQAGRMVLSVTPDDLVRVNMGEPNFEPQQVPFRANKAENLYLLRVAEQTVMFGAVSM
FT                   GNPHCVIQVESTKTAQVELLGPVLESHERFPERVNVGFMEIISPEHIRLRVYERGAGET
FT                   QACGSGACAAVACGIQQGILSQKVRVDLPGGTLHIAWKGVGQPLYMTGPATHVYDGFIH
FT                   L"
     MAHPAEQKMQ FSKMHGLGND FMVVDAVTQN VFFSPELIRR LSDRHLGIGF DQLLVVEPPY        60
     DPDLDFHYRI FNADGSEVAQ CGNGARCFAR FVQLKGLTNK SDIRVSTQAG RMVLSVTPDD       120
     LVRVNMGEPN FEPQQVPFRA NKAENLYLLR VAEQTVMFGA VSMGNPHCVI QVESTKTAQV       180
     ELLGPVLESH ERFPERVNVG FMEIISPEHI RLRVYERGAG ETQACGSGAC AAVACGIQQG       240
     ILSQKVRVDL PGGTLHIAWK GVGQPLYMTG PATHVYDGFI HL                          282
//

If you have problems or comments...

PBIL Back to PBIL home page