(data stored in SCRATCH zone)

EMBL: CP001875.DEGQ

CP001875.DEGQ        Location/Qualifiers
FT   CDS             complement(480709..482184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="PANA_0410"
FT                   /product="DegQ"
FT                   /note="Protease DegQ precursor; Similar to Pantoea sp.
FT                   At-9b, protease Do (NCBI: ZP_05730849.1); COG:
FT                   Posttranslational modification, protein turnover,
FT                   chaperones; Subcellular localization as predicted by Psort
FT                   2.0: Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75577"
FT                   /db_xref="GOA:D4GI47"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI47"
FT                   /protein_id="ADD75577.1"
FT                   /translation="MTLCPLFLRTPAANGCLIDLLPHFCSESVVAMKKQARLLSALALS
FT                   IGMSLAAAPGAMATLPAQIQSQPLPSLAPMLEKVLPAVVSVHVEGTQSDAQAQTQDIPE
FT                   PLKRFFGQLPGGAPSQPQPFEGLGSGVIIDAAKGYVLTNNHVVNGADKINVQLGDGSEY
FT                   DAKLIGHDEQTDIALIQIQGAKNLTQIKVADSDQLKVGDFAVAIGNPFGLGQTATSGII
FT                   SALGRSGLNLEGLENFIQTDAAINRGNSGGALVNLNGELIGINTAILASSGGNIGIGFA
FT                   IPSDMAMNLAEQLIKYGEVKRGQLGIKGTEMTADIAKAFNVDAQRGAFVSEVLPQSAAQ
FT                   KAGIKSGDIIVSVNDKPITSFAELRVKIGTTAPGEKVKLGLLREGKPVSVDVTLEQSAQ
FT                   TTASAQLLSPALQGATLSDGQTKTGDKGVKIDAIEKGTPAEQVGLQKDDVIIGVNRTRI
FT                   QNIAEMRKVLEAKPPVMALNVVRGEESIYLLLR"
     MTLCPLFLRT PAANGCLIDL LPHFCSESVV AMKKQARLLS ALALSIGMSL AAAPGAMATL        60
     PAQIQSQPLP SLAPMLEKVL PAVVSVHVEG TQSDAQAQTQ DIPEPLKRFF GQLPGGAPSQ       120
     PQPFEGLGSG VIIDAAKGYV LTNNHVVNGA DKINVQLGDG SEYDAKLIGH DEQTDIALIQ       180
     IQGAKNLTQI KVADSDQLKV GDFAVAIGNP FGLGQTATSG IISALGRSGL NLEGLENFIQ       240
     TDAAINRGNS GGALVNLNGE LIGINTAILA SSGGNIGIGF AIPSDMAMNL AEQLIKYGEV       300
     KRGQLGIKGT EMTADIAKAF NVDAQRGAFV SEVLPQSAAQ KAGIKSGDII VSVNDKPITS       360
     FAELRVKIGT TAPGEKVKLG LLREGKPVSV DVTLEQSAQT TASAQLLSPA LQGATLSDGQ       420
     TKTGDKGVKI DAIEKGTPAE QVGLQKDDVI IGVNRTRIQN IAEMRKVLEA KPPVMALNVV       480
     RGEESIYLLL R                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page